KEGG   Streptomyces bingchenggensis: SBI_05003Help
Entry
SBI_05003         CDS       T01678                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SBI_05003 (gpmA)
   01230 Biosynthesis of amino acids
    SBI_05003 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBI_05003 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SBI_05003 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SBI_05003 (gpmA)
Enzymes [BR:sbh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SBI_05003 (gpmA)
Exosome [BR:sbh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SBI_05003 (gpmA)
  Exosomal proteins of melanoma cells
   SBI_05003 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6191200..6191961)
Genome map
AA seq 253 aa AA seqDB search
MADAPYKLILLRHGESEWNAKNLFTGWVDVNLNEKGEKEAVRGGELLKDAGLLPDVVHTS
LQKRAIRTAQLALESADRHWIPVHRSWRLNERHYGALQGKDKAQTLAEFGEEQFMLWRRS
YDTPPPPIDADSEWSQADDPRYATIPPELRPRTECLKDVVARMLPYWYDGIVPDLLAGRT
VLIAAHGNSLRALVKHLDGISDADIAGLNIPTGIPLAYELDADFRPVKPGGTYLDPEAAK
AAIEAVKNQGKKK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgcaccgtacaagctgatcctccttcgccacggcgagagcgagtggaacgcg
aagaacctgttcaccggctgggtggacgtcaacctcaacgagaagggcgagaaggaggca
gtccgcggcggtgagctgctgaaggacgccggcctgctccccgacgtggtccacacgtcc
ctccagaagcgcgccatccgcaccgcgcagctcgccctggagtccgccgaccgccactgg
atcccggtccaccgctcctggcggctcaacgagcgccactacggtgccctccagggcaag
gacaaggcccagaccctcgccgagttcggcgaggagcagttcatgctctggcgccgctcg
tacgacaccccgccgccgcccatcgacgccgactccgagtggtcgcaggccgacgacccg
cgctacgcgaccatcccgccggagctgcggccgcgcaccgaatgcctcaaggacgtcgtc
gcgcgcatgctcccgtactggtacgacggcatcgtcccggacctcctggccggccgcacg
gtcctgatcgccgcccacggcaactcgctgcgcgccctggtcaagcacctcgacggcatc
tccgacgccgacatcgcgggcctcaacatccccaccggcatcccgctcgcctacgagctc
gacgccgacttccgccccgtcaagccgggcggcacctacctcgacccggaggccgcgaag
gcggccatcgaggcggtcaagaaccagggcaagaagaagtaa

DBGET integrated database retrieval system