KEGG   Streptomyces bingchenggensis: SBI_05074Help
Entry
SBI_05074         CDS       T01678                                 

Gene name
thrC4
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SBI_05074 (thrC4)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SBI_05074 (thrC4)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SBI_05074 (thrC4)
Enzymes [BR:sbh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SBI_05074 (thrC4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6263556..6264884
Genome map
AA seq 442 aa AA seqDB search
MIQVMQRPNSRSAQPTSRPPRSNAARPEPEQGPRPRPRSQSLATGQRSLGDPAVHYSLWP
PLINGCPRTSTDAVAYPLEVDYAYDRVPADLFGRPAAHGLERWAPLLPPLAAPGLGEGNT
PLVRLPDGVYIKDESRNPTWSHKDRLNRVAVSAAKASGARGVVVASSGNHGAAAAAYAAR
AGLPCVVIASPSAPPAVASFVRAYGALVVTGPYESWKPLTRRIVEEFGYQPVSSLTTTAH
TGHPFGTEGYKTIAYEIFLDLGETPEAVYVPTGYGELLFGVWKGFHELTLLGLADRTPRL
YACEPAATGALTTAIRTGRPAAQVPVGPTEAYGISCPVGGYRGVVAVRESRGAALTVTDE
QMAAARDELAGQGMWVELSSAAGLAGLRARREDPARPGDASGPVVCVTTSSGFKDSATAT
RGHPTVPADWDTVAAALRGLLG
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgatccaggtcatgcagcgccccaactcccggtccgcacagcccacatcccgtccccca
cggtccaacgccgcacgccccgaacccgagcaggggccgcggccacggccgcggtcgcag
tcgctcgcgaccggtcagcggtccctgggggatccggcggtccactactccctgtggccg
ccgctcatcaacggctgcccgcgcacctccaccgacgccgtcgcgtacccgctggaggtc
gactacgcgtacgaccgggtgcccgccgacctgttcggccgccccgccgcacacggcctc
gaacgctgggccccgctgctcccgccgctggccgcccccgggctcggcgaggggaacacg
cccctggtccggctgcccgacggcgtctacatcaaggacgagtcgcgcaaccccacctgg
agccacaaggaccggctcaaccgcgtcgccgtcagcgccgcgaaggcgagcggggcgcgc
ggcgtcgtggtggcctcctccggcaaccacggcgccgccgccgcggcctacgcggcccgc
gccgggctgccgtgcgtcgtgatcgcctccccctccgccccgcccgccgtcgcctccttc
gtacgcgcctacggggcgctggtggtcaccgggccctacgagtcgtggaaaccgctgacg
cggcggatcgtggaggagttcggctatcagccggtcagcagcctgaccaccaccgcccac
accggccaccccttcggcaccgagggctacaagaccatcgcgtacgagatcttcctggac
ctcggcgagacgcccgaggcggtgtacgtgcccaccggctacggcgaactgctcttcggc
gtctggaagggcttccacgagctgaccctgctgggcctggccgaccgcaccccgcggctg
tacgcatgcgagcccgccgccacgggcgcgctgaccaccgcgatccgcaccggccgcccc
gccgcccaggtcccggtcgggccgaccgaggcgtacgggatctcctgccccgtgggcggc
taccgcggggtggtggccgtacgcgagagccgcggcgcggcgctgaccgtcaccgatgag
cagatggccgccgcccgcgacgaactcgccggccagggcatgtgggtcgagctgtcctcc
gcggcggggctggccgggctgcgcgcccgccgggaggaccccgcgcgcccgggggacgcc
tcgggccccgtggtgtgcgtcaccacctccagcggcttcaaggacagcgccaccgccacc
cgcggccacccgaccgtgcccgcggactgggacaccgtcgccgcggcgctgcgcggtctg
ttgggctga

DBGET integrated database retrieval system