KEGG   Streptomyces bingchenggensis: SBI_05445Help
Entry
SBI_05445         CDS       T01678                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00010  Glycolysis / Gluconeogenesis
sbh00020  Citrate cycle (TCA cycle)
sbh00620  Pyruvate metabolism
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
sbh01120  Microbial metabolism in diverse environments
sbh01130  Biosynthesis of antibiotics
sbh01200  Carbon metabolism
Module
sbh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBI_05445
   00020 Citrate cycle (TCA cycle)
    SBI_05445
   00620 Pyruvate metabolism
    SBI_05445
Enzymes [BR:sbh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SBI_05445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ADI08565
UniProt: D7CAJ8
Position
6672271..6673761
Genome map
AA seq 496 aa AA seqDB search
MTMTATDQRFREFKMPDVGEGLTEAEILKWYVAPGDRVADGQVVCEVETAKAAVELPIPF
DGVVHEVRFGEGSTVDVGTAIISVDTQPGAGDAAASSEPAAAPAEPAEAAEAAQAAESGG
RQANLVGYGAAPSSTKRRPRKPRSGAEAAPALGVPAQPAPAPAAAAPAAPAPAPAPAPAP
AVAPSQAELNGHAKAARPLAKPPIRKLAKDLGIDLATVTPTGPDGTVTREDVHAAAAPAP
AAVAEPVAEPAAAVAEAAPASVVGRERRVPIKGVRKATAQAMVSSAFTAPHVTEFITVDV
TRTMKLVADLKQDPDMAGLRVNPLLLVAKAFLVAIRRNPDINASWDEAAQEIVYKDYVNL
GIAAATPRGLIVPNIKDAGSLTLPELASALGELVSIAREGRTSPAAMSGGTVTITNVGVF
GIDAGTPILNPGESAILAFGAVKLQPWVHKGKVKPRQVTTLALSFDHRMVDGELGSKVLA
DIAAILEQPKRLITWG
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatgactgcaaccgatcagcgcttccgtgagttcaagatgcccgatgtgggcgaa
gggctcaccgaggcggagatcctcaagtggtacgtggcgccgggcgacagggtcgccgac
ggccaggtggtgtgtgaggtcgagaccgcgaaggcggcggtcgaactgccgattccgttc
gacggtgtggtgcacgaggtgcgcttcggcgagggctcgacggtggacgtgggcaccgcg
atcatctcggtggacacccagccgggtgcgggggacgcggctgcctcctcggagcccgcc
gccgccccggccgagcccgccgaggcggccgaggctgcccaggctgccgagtcggggggg
cgccaggccaacctggtcggctacggcgcggcgccctcgtccaccaagcgccgcccgcgc
aagccgcggtccggtgccgaggcggcgcccgcccttggcgtcccggcccagcccgccccc
gcgcccgctgccgccgccccggcggcccctgcccctgcccctgcacccgccccggccccg
gccgtcgcgccgtcgcaggccgagctgaacggccacgccaaggccgcgcgcccgctggcc
aagcccccaatccgcaagctcgccaaggacctgggcatcgacctggcgacggtcaccccg
accggccccgacggcaccgtcacccgcgaggacgtccacgcggccgcggcccccgcgccc
gccgccgtggccgagcccgtggcggagcccgcagcggccgtggcggaggcggcccctgcc
tccgtcgtcggccgggagcgccgggtaccgatcaagggcgtacggaaggccaccgcccag
gcgatggtcagcagcgccttcacggccccgcatgtgaccgagttcatcaccgtcgacgtc
acgcgcaccatgaagctcgtcgccgacctcaagcaggacccggacatggccgggctgcgg
gtgaacccgctgctgctggtcgccaaggccttcctggtggccatccggcgcaacccggac
atcaacgcgtcctgggacgaggccgcccaggagatcgtctacaaggactacgtcaatctc
ggcatcgcggccgccacgccccgggggctgatcgtccccaacatcaaggacgcgggctcg
ctcaccctgcccgaactggcgtccgccctcggcgagctggtctccatcgcccgcgagggc
cggaccagcccggcggcgatgtccggcggcacggtcaccatcaccaacgtcggcgtcttc
ggcatcgacgccggcaccccgatcctcaacccgggcgaatccgcgatcctcgccttcggc
gcggtcaagctccagccgtgggtccacaagggcaaggtcaagccgcgccaggtgaccacg
ctcgcgctctccttcgaccaccgcatggtcgacggcgagctgggctccaaggtgctcgcg
gatatcgcggccatcctggagcagcccaagcgcctcatcacctggggctga

DBGET integrated database retrieval system