KEGG   Streptomyces bingchenggensis: SBI_05611Help
Entry
SBI_05611         CDS       T01678                                 

Definition
secreted endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
sbh  Streptomyces bingchenggensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6853326..6854015)
Genome map
AA seq 229 aa AA seqDB search
MHEDNAPARPVNRRDFIGRAGALALATTGLMLPGTAYADTTITTNQTGTNNGFYYSFWTD
GGGSVAMTLASGGSYRTSWTNCGNFVCGKGWSNGGRRSVNYSGSFNPSGNGYLALYGWTS
NPLVEYYIVDNWGTYRPTGTYKGAVTSDGGTYDIYMTTRYNAPSVEGTRTFNQYWSVRQS
KKTGGTITTGNHFDAWARSGMNLGTFKYYMILATEGYQSSGNSNLTVSG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaggacaacgcccccgcacgcccggtcaaccgcagggacttcatcggccgcgcc
ggcgccttggcgctggccacgaccgggctgatgctccccggcaccgcgtacgccgacacg
accatcaccacgaaccagaccggcaccaacaacggcttctactactcgttctggaccgat
ggcggcgggtcggtcgccatgacccttgcgtccggcggcagttaccggacctcgtggacc
aactgtggcaatttcgtctgcggtaagggctggagcaacggcggacgccggagtgtgaac
tactccggcagcttcaacccgtccggcaatggctatttagctctctatgggtggacctca
aacccgctcgtggagtactacatcgtcgacaactggggcacctaccggcccacgggcacc
tacaagggcgcggtcaccagcgacggcggcacgtacgacatctacatgacgacgcgctac
aacgcgccctccgtcgaaggcactcgcacgttcaatcagtactggagcgtccggcagtcg
aagaaaacgggcgggaccatcaccacgggcaatcacttcgacgcctgggcccgttccgga
atgaatctgggcaccttcaagtactacatgatcctcgcgaccgagggatatcagagcagc
gggaactcgaatctcacggtgagtggctga

DBGET integrated database retrieval system