KEGG   Streptomyces bingchenggensis: SBI_05828Help
Entry
SBI_05828         CDS       T01678                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00010  Glycolysis / Gluconeogenesis
sbh00620  Pyruvate metabolism
sbh00640  Propanoate metabolism
sbh00680  Methane metabolism
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
sbh01120  Microbial metabolism in diverse environments
sbh01130  Biosynthesis of antibiotics
sbh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBI_05828
   00620 Pyruvate metabolism
    SBI_05828
   00640 Propanoate metabolism
    SBI_05828
  Energy metabolism
   00680 Methane metabolism
    SBI_05828
Enzymes [BR:sbh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SBI_05828
Lipid biosynthesis proteins [BR:sbh01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SBI_05828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADI08948
UniProt: D7CEQ2
Position
complement(7093290..7095251)
Genome map
AA seq 653 aa AA seqDB search
MSNESLANLLREERRFAPPADLAANANVTAEAYERAKADRLGFWAEQARRLTWAAEPTET
LDWSNPPFAKWFADGKLNVAYNCVDRHVENGLGDRVAIHFEGEPGDTRSVTYAELQREVS
KAAHALTELGVRTGDRVAIYLPMIPETVVAMLACARIGAPHSVVFGGFSADALATRIEDA
DARVVITADGGYRRGKPSALKPAVDEALTRPGTENVGNVLVVRRTGQEVAWAEGRDVWWH
ELVDRQPEQHTPEAFDAEHPLFILYTSGTTGKPKGILHTTGGYLTQVSYTHHAVFDLKPE
SDVYWCTADVGWVTGHSYIVYGPLSNGATQVLYEGTPDTPHQGRWWEIVQKYGVTILYTA
PTAIRACMKWGDDIPAKFDLSSLRILGSVGEPINPEAWVWYRKHIGADKTPVVDTWWQTE
TGGMMISPLPGVTETKPGSAQIPLPGISATVIDDDANEVPDGSGGYLVLTEPWPSMLRTI
WGDDQRYLDTYWSRFANRYFAGDGAKKDDDGDIWLLGRVDDVMLVSGHNISTTEVESALV
SHPKVAEAAVVGATDPQTTQAICAFVILRGGAAEEDGLVEELRAHVSKHLGPIAKPKRIL
PVAELPKTRSGKIMRRLLRDVAENRTLGDVTTLTDSSVMELIQSKLPSAASED
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaacgaaagcctggccaaccttcttcgggaggagcgtcgcttcgctccacccgcc
gacctggccgccaacgccaatgtcacggcggaggcgtatgagcgggcgaaggctgaccgc
ctgggcttctgggccgagcaggcccgtcggctgacctgggccgccgagccgaccgagacg
ctggactggtcgaacccgccgttcgcgaagtggttcgccgacggcaagctcaatgtggcg
tacaactgcgtcgaccgccatgtggagaacgggctgggcgaccgggtggccatccacttc
gagggcgagcccggcgacacccgctccgtcacctacgccgagttgcagcgcgaggtctcc
aaggcggcgcatgccctgaccgagctcggggtccggaccggtgaccgggtcgcgatctat
ctgccgatgatcccggagaccgtcgtcgcgatgctggcctgtgcccgcatcggcgccccg
cactccgtggtcttcggcggcttctcggccgacgctctcgccacccgcatcgaggacgcc
gacgcccgggtcgtgatcaccgcggacggaggctaccgccgtggcaagccctccgcgctc
aagcccgccgtcgacgaggccctgacccgtccgggcaccgagaacgtgggcaatgtgctg
gtggtccgccgcaccggccaggaggtggcctgggccgagggccgcgatgtgtggtggcac
gagctcgtcgaccgccagccggagcagcacacccccgaggcgttcgacgccgagcacccg
ctcttcatcctctacacctcgggcaccaccggtaagcccaagggcatcctgcacaccacg
ggcggctatctcacccaggtctcctacacccaccacgccgtcttcgacctcaagccggag
tcggatgtgtactggtgcacggccgacgtcggctgggtcaccggccactcgtacatcgtc
tacggaccgctgtccaacggcgcgacccaggtgctctacgagggcaccccggacaccccg
caccagggccgctggtgggagatcgtccagaagtacggcgtcacgatcctctacaccgcc
ccgaccgcgatccgcgcctgcatgaagtggggcgacgacatcccggccaagttcgacctg
tcctcgctgcgcatcctcggctcggtcggcgagccgatcaaccctgaggcatgggtctgg
taccgcaagcacatcggcgcggacaagacgcccgtggttgacacctggtggcagaccgag
accggcgggatgatgatcagcccgctgccgggtgtcaccgagaccaagcccggttcggcc
cagatcccgctccccggtatctccgccaccgtcatcgacgacgacgccaacgaggtgccg
gacggctccggcggctacctggtcctcaccgagccctggccgtccatgctccgcaccatc
tggggcgacgaccagcgctatctggacacctactggtcgcgcttcgccaaccgctacttc
gcgggcgacggcgccaagaaggacgacgacggcgacatctggctgctcggccgggtcgac
gacgtcatgctggtctccggccacaacatctccacgaccgaggtggagtcggcgctcgtc
tcgcaccccaaggtcgccgaggccgcggtcgtcggggccaccgacccccagaccacccag
gccatctgcgccttcgtcattctgcgcggcggcgccgcggaggaagacggtctggtcgag
gagttgcgggcccacgtctcgaagcacctcggcccgatcgccaagcccaagcggatcctg
ccggtggccgagctgcccaagactcgctccggcaagatcatgcgtcggctgctgcgcgat
gtcgccgagaaccgcaccctcggcgatgtcaccaccctcaccgactcttccgtcatggag
ctcatccagagcaagctgccgtccgccgccagcgaggactga

DBGET integrated database retrieval system