KEGG   Streptomyces bingchenggensis: SBI_05889Help
Entry
SBI_05889         CDS       T01678                                 

Definition
glycoside hydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SBI_05889
Enzymes [BR:sbh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SBI_05889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7164505..7165779
Genome map
AA seq 424 aa AA seqDB search
MDNNVPTVSETTESKRGPRSYRLRVGIAAGVVVAAAIGGTVTAFALNSDSDSSSSSSASS
ATAKGAAVDGPLSTRGGDIVDSKGHKVVLTGVNWFGMETGSFAPHGLWTRNWKSMLDQIA
HNGFNTIRLPYSNEMFAAKSKPNGIDFKQNPDLKGLTGQQIMDKIVKGATDRGMMVLLDQ
HRPDQYGQSELWYSQNLTEKQWVDDWTQLAKRYKDNPRVIGADLHNEPRGQATWGDGNPK
TDWRLAAEKAGNAIHAVNKNWLIFVEGTDRHKNEQFWWGGDLQGVKKYPVKLKEPNKVVY
SAHDYGPGVYNQNWFMAKDFPKNMPAIWQKHWAYIKKQNIAPLLLGEFGGRKTAGKSSEA
VWQNALMDYLKKNQISYTYWALNPNSGDTGGVLNNDWKTVDKNKMKMLSKYQTPLLSAKG
KTSE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggacaacaacgttccgaccgtttccgaaaccactgagtcgaagcgtgggccgcgttcc
taccggctgcgtgtcggtatagcggccggagttgtcgtggctgctgccatcggtggcacc
gtgaccgcgttcgctctgaattccgattctgattcgtcgtccagctcttccgcctcgtcc
gcgacggccaagggcgcggccgtcgacggtccgctgtccacccgtggtggcgacatcgtg
gactccaagggccacaaggtcgtgctgaccggtgtcaactggttcggcatggagaccggt
agcttcgcgccgcacggcctgtggacccgtaactggaagagcatgctcgaccagatcgcg
cacaacggcttcaacacgatccggctcccgtactccaacgagatgttcgcggccaagagc
aagcccaacgggatcgacttcaagcagaaccctgacctgaagggcctcaccggccagcag
atcatggacaagatcgtcaagggtgccaccgaccgcgggatgatggtgctgctggaccag
caccgtcctgaccagtacggccagagtgagctgtggtacagccagaacctcaccgagaag
cagtgggtggacgactggacccagctggccaagcgctacaaggacaacccccgggtgatc
ggcgccgacctgcacaatgagccgcgtggccaggccacgtggggcgacggcaacccgaag
accgactggcgcctggcggccgagaaggccggtaacgcgatccacgccgtcaacaaaaac
tggctgatcttcgtcgagggcaccgaccgtcacaagaacgagcagttctggtggggcggc
gacctccagggtgtgaagaagtacccggtcaagctgaaggagcccaacaaggtcgtctac
tcggcgcacgactacggcccgggtgtgtacaaccagaactggttcatggccaaggacttc
ccgaagaacatgccggccatctggcagaagcactgggcctacatcaagaagcagaacatc
gctccgctgctgctcggtgagttcggtggccgcaagaccgcgggcaagagctccgaggcc
gtgtggcagaacgccctgatggactacctcaagaagaaccagatcagctacacctactgg
gccctgaacccgaactcgggtgacaccggtggtgtcctcaacaacgactggaagacggtc
gacaagaacaagatgaagatgctgtccaagtaccagacgccgcttctgtcggcgaagggg
aagacgtcggagtaa

DBGET integrated database retrieval system