KEGG   Streptomyces bingchenggensis: SBI_05922Help
Entry
SBI_05922         CDS       T01678                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SBI_05922 (folE)
Enzymes [BR:sbh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SBI_05922 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7202255..7202860
Genome map
AA seq 201 aa AA seqDB search
MTDSISLDGQGPVGVFDEKRAEQAIRELLIAVGEDPDREGLRETPGRVARAYREIFAGLR
QKPEEVLTTTFDLGHDEMVLVKDIEVMSSCEHHLVPFVGVAHVGYIPSNDGKITGLSKLA
RLVDVFARRPQVQERLTTQIADSLMRILEPRGVIVVVECEHMCMTMRGVRKPGAKTLTSA
VRGQLRDPATRAEAMSLIMAR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaccgactccatctcgctggacggccagggccccgtcggcgtgttcgacgaaaagcgc
gccgagcaggcgatccgcgagctgcttatcgccgtcggcgaggaccctgaccgggagggg
ctgcgggagaccccggggcgggtggcccgtgcgtaccgggagatattcgcggggctgcgg
cagaagcccgaggaggtcctgaccacgaccttcgacctgggccatgacgagatggtgctg
gtgaaggacatcgaggtgatgtcctcgtgcgagcaccacctggtgcccttcgtgggcgtc
gcccatgtcggctatatcccgtccaacgacggcaagatcaccgggctgtccaagctggcc
cggctggtcgatgtcttcgcccgtcgcccgcaggtccaggagcggctgaccacgcagatc
gccgactccctgatgcggatcctggagccgcgcggtgtgatcgtggtggtcgaatgcgag
cacatgtgcatgaccatgcgcggggtgcgcaagcccggggcgaagacgctcacctcagcc
gtgcgcggccagctgcgcgatccggcgacccgcgccgaggcgatgagcctcatcatggcg
cgctag

DBGET integrated database retrieval system