KEGG   Streptomyces bingchenggensis: SBI_05924Help
Entry
SBI_05924         CDS       T01678                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sbh00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7203552..7204145)
Genome map
AA seq 197 aa AA seqDB search
MSSSDPTVQPVPASVVERVDAADVTLSNPKWAVISLGSNLGNRLETLQGAVDALEDTPGL
RVKAVSPVYETEPWGVEPGAQATYFNAVVLIKTTLPPSSLLERGHAIEEAFERVRDERWG
PRTLDVDIVTYQDVISDDPVLTLPHPRAHERAFVLVPWHDVDPGAEVPGLGAVSRLLAEV
GREGVQARADLELRLPE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcagcgacccgaccgtgcagcccgtcccagcctccgtcgtggagcgggtggac
gcggccgatgtgacgttgtcgaatccgaaatgggcggtgatctcgctcggcagcaatctg
ggcaatcgcctggagaccctgcagggcgcggtcgacgcgctggaggacaccccgggcctg
cgggtcaaggcggtctctccggtgtacgagaccgagccgtggggggtggaaccgggcgcc
caggcgacgtatttcaacgccgtggtgctgatcaaaacgacgctgccgccctcctcgctg
ctggagcggggacacgccatcgaggaggcgttcgagcgagtgcgcgatgagcgctggggc
ccccggacgctggatgtggacatcgtcacgtaccaggacgtgatctccgacgacccggtg
ctcaccctgccgcacccccgcgcccacgagcgcgccttcgtgctcgtcccctggcacgac
gtggacccgggggccgaggtccctgggctcggggcggtctcgcggctgctggccgaggtg
ggccgggagggcgtacaggcgcgggcggacctggaactgcggctgcccgaatag

DBGET integrated database retrieval system