KEGG   Streptomyces bingchenggensis: SBI_06014Help
Entry
SBI_06014         CDS       T01678                                 

Definition
2-dehydropantoate 2-reductase
Orthology
K00077  
2-dehydropantoate 2-reductase [EC:1.1.1.169]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:sbh00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7309288..7310289)
Genome map
AA seq 333 aa AA seqDB search
MRYVVIGAGAVGGAIGGRLAQSGHDVVLVARGAHYEALRRDGLRLLTPDGTHRLPVPVAD
RPEAVELRPDDVLVLAVKTQDSVAALDAWAPRPVAGGGTAADRLPLVCAQNGVESERLAL
RRFRRVYAMCVWLPATYLEPGEVIAPCAPCTGALHLGRYPSGADETVRLIAADLEKSHFL
APVVPDVMRWKYAKLLNNVANAVEAVCGPDGGEEAAALVRRAKAEASAVFDAAGIDRASD
AEQSAVRAGKMDIRPVAGGAARGGGSSWQSLVRGSGTVEADYLNGEIVLLGRLHGVPTPV
NEALRRTANECARERRTPGTVTAAQLTRIVDTS
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacgtcgtcatcggagcgggcgccgtcggaggcgcgatcggcgggcggctcgcc
cagagcgggcacgacgtcgtcctggtggcgcgcggagcgcactacgaggcgctgcggcgg
gacgggctgcggctgctgacgcccgacggcacacaccggctcccggtgcccgtggccgac
cggcccgaggccgtcgagctgcgccccgacgacgtgctggtcctggccgtgaagacccag
gacagcgtggccgcgctggacgcctgggcgccccgcccggtggccggcggcgggacggcg
gccgaccggctgccgctggtgtgcgcgcagaacggcgtggagagcgagcggctggcgctg
cggcgcttccgccgggtgtacgcgatgtgcgtctggctgcccgccacctacctggagccg
ggcgaggtcatagccccctgcgcgccctgcaccggcgcgctccacctgggccgctatccg
tccggagcggacgagacggtccggctgatcgcggccgacctggagaagtcccacttcctc
gcgccggtcgtgccggacgtgatgcgctggaagtacgccaagctgctcaacaacgtcgcc
aacgctgtggaggcggtctgcgggccggacgggggcgaggaggcggcggccctggtacgg
cgcgcgaaggcggaggcgagcgccgtcttcgacgcggcgggcatcgaccgcgcgagcgac
gccgagcagagcgcggtgcgcgccggaaagatggacatacgccccgtcgccggcggtgcg
gcgcggggcggcggctcgtcgtggcagagcctggtccggggctccggaaccgtcgaggcg
gactatctgaacggcgagatcgtgctactgggccggctccacggggtgccgaccccggtc
aacgaggcgctgcggcgcaccgcgaacgagtgcgcgcgcgagcgccgtaccccgggcacg
gtcaccgccgcgcaactcacccggatcgtcgacacgtcctga

DBGET integrated database retrieval system