KEGG   Streptomyces bingchenggensis: SBI_06081Help
Entry
SBI_06081         CDS       T01678                                 

Definition
cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    SBI_06081
Enzymes [BR:sbh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     SBI_06081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7384923..7386554)
Genome map
AA seq 543 aa AA seqDB search
MTANLTRRHILGLAALRGAAALGLTRIALSPAAAADRPAPAASAEYAPAVVVGSGYGAAV
AALRLGEAGVKTLVLEMGRLWNAPASDGKVYCSMTAPDRRSMWFKTRTEAPLATFLWLDV
INKDITPYPGVLDRVRFPNMSVYVGRGVGGGSLVNGGMAVTPSRAYFQEVLPQVDADAMY
ATYFPLANRMLGAATVPSAWFESTEWYKYARVSRDQAKTAGLKTVFVPNVYDFDYMQREA
AGTATKSALAQEVIYGNNFGKRSLDKTYLAAALGTGNVTIRTLSRARAIRRAADGTYVLT
VDRLDDTGAVVGTDEISCRSLFLGAGSLGTTELLLRARETGTLPALSPQIGRGWGGNGNV
MLGRANHIWNTTGANQSTIPVMGIDDWSNATNPVFAEIAPLPAGTETWASLYLAITKNPE
RGTFTYDAAKDAAVLNWTGTQSAPSVTAAKSLFDRLNSANGTIYRYDLFGDTRAFAADFC
YHPLGGCVLGRATDAYGRAVGYDRLYVTDGSLIPGSIGVNPFVTITALAERTMARVLAED
GVG
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaaatctgacgcgtcgtcatattcttggtctggccgccctgcgcggcgccgcg
gccctcgggctcacccggatagccctctccccggcggccgccgccgaccgccccgccccc
gcggcgagcgccgaatacgccccggccgtcgtcgtcggctccggctacggtgcggcggtc
gccgccctgcggctcggcgaggcgggcgtgaagaccctggtcctggagatggggcgactg
tggaacgccccggcctccgacggcaaggtctactgttcgatgaccgcgcccgaccggcgc
tccatgtggttcaagaccagaaccgaggcgccgctggccaccttcctgtggctggacgtc
atcaacaaggacatcacgccctaccccggcgtcctggaccgcgtccgcttccccaatatg
tccgtctacgtcggacgcggcgtcggcggcgggtcgctcgtcaacgggggcatggcggtc
accccgtcccgcgcgtacttccaggaggtgctgccccaggtcgacgccgatgcgatgtac
gccacgtacttcccgctcgccaaccgcatgctcggcgccgccaccgtcccgtccgcctgg
ttcgagtccactgagtggtacaagtacgcccgcgtctcccgcgaccaggcgaaaacggcg
ggcctgaagaccgtcttcgtccccaatgtgtacgacttcgactacatgcagcgcgaggcc
gccgggaccgccaccaagtccgccctcgcccaggaggtcatctacggcaacaacttcggc
aagcgcagcctcgacaagacctatctcgcggcggccctcggcacggggaacgtcaccatc
cgcaccctcagccgcgcccgcgccatccgcagggccgccgacggcacgtacgtcctgacc
gtggaccgcctcgacgacaccggcgcggtcgtcggtaccgacgagatctcctgccgctcg
ctcttcctcggcgcgggcagcctcggcaccaccgagctcctgctgcgcgcccgcgagacc
ggcaccctgcccgcactgagcccgcagatcggccgcggctggggcggcaacggcaacgtc
atgctcggccgcgccaaccacatatggaacacgaccggcgccaaccagtcgacgatcccg
gtgatggggatcgacgactggtccaacgccaccaaccccgtcttcgccgagatcgccccg
ctcccggccggcaccgagacctgggccagcctctacctggccatcaccaagaaccccgag
cgcggcaccttcacctacgacgccgccaaggacgccgccgtgctgaactggaccggcacc
cagagcgccccctccgtcaccgccgccaaatccctcttcgaccgcctcaactccgccaac
ggcaccatctaccgctacgacctcttcggcgacacccgcgccttcgccgccgacttctgc
taccaccccctgggcggctgcgtcctgggccgcgccacggacgcgtacggccgggccgtc
ggctacgacaggctgtacgtgaccgacggctcgctcatcccgggctcaatcggcgtcaac
cccttcgtgaccatcacggccctggccgagcgcaccatggcgcgcgtcctggccgaggac
ggcgtgggctga

DBGET integrated database retrieval system