KEGG   Streptomyces bingchenggensis: SBI_06554Help
Entry
SBI_06554         CDS       T01678                                 

Definition
bifunctional uroporphyrinogen-III synthetase/response regulator domain-containing protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sbh00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7905361..7906566
Genome map
AA seq 401 aa AA seqDB search
MHRDHNATPDATPDATPAPTTPDAPAAIGPLAGFTVGVTAARRADELAALLRRRGAAVMH
APALRIVPLADDAELLTATKQLLDHAPDVVIATTAIGFRGWVEAADGWGLGDSLLARLRG
ARLLARGPKVRGAIRAAGLTEEWFPASESLAEVLDRLLEEGVDGSRIAVQLHGEPLPGFV
ESLRVAGAEVVGVPVYRWMPPEDIGPVDRLLDATVARVLDALTFTSAPAAASLLDRAERR
GMRDELLDALRHDVLPACVGPVTALPLEAHGIPTSQPERFRLGPLVQLLTHELPGRVRPL
PVAGRRLEIRGHAALVDGELRAVPPAGMALLRALARRPGWVVARADLLRSLPGAGRDEHA
VETAMARLRTALGAPKLIQTVVKRGYRLALDPVADTKYADV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgagaccacaacgccacccccgacgccacccccgacgccacccccgcgcccacc
acccccgacgcgcccgccgccatcgggccgctcgccgggttcaccgtcggcgtcaccgcc
gcccgccgcgccgatgagctcgccgcgctgctgcggcggcggggcgcggccgtcatgcac
gctcccgcgctgcgcatcgtgccgctcgccgacgacgcggaactgctcaccgccaccaag
cagctgctcgaccacgcccccgacgtggtgatcgcgaccaccgccatcggcttccggggc
tgggtcgaggccgccgacggatggggtctcggggactcgctgctggcccggctgcgcggc
gcccggctgctggcgcgcgggcccaaggtgcggggcgcgatccgggccgccgggctgacc
gaggagtggttcccggcgtccgagtcgctggccgaagtgctcgaccggctgctggaggag
ggggtcgacggcagccggatcgcggtgcagctgcacggcgagccgctgcccggcttcgtg
gagtcgctgcgcgtggcgggcgcggaggtggtcggggtgccggtgtaccggtggatgccg
cccgaggacatcggccccgtggaccgcctcctcgacgcgaccgtagcccgcgtgctggac
gccctcaccttcaccagcgccccggccgccgcgagcctgctggaccgggccgagcggcgt
ggcatgcgcgacgaactgctggacgcgctgcgccacgatgtgctgcccgcctgtgtcggg
ccggtcaccgcactgccgctcgaggcccatggcatccccaccagccagcccgaacgcttc
cgcctcggcccgctcgtacagctgctgacccatgaactgcccggccgggtgaggccgttg
ccggtcgccgggcgccgcctggagatccgcgggcacgcggccctggtggacggcgagctg
cgcgccgtaccgccggccggtatggccctgctgcgcgccctggcccgccgcccgggctgg
gtcgtcgcccgcgcggatctgctgcgctccctgccgggcgcggggcgcgacgagcacgcc
gtcgagacggcgatggcccgcctccgtacggccctcggcgccccgaagctcatccagacg
gtggtcaaacgcggctaccggctggcgctggatccggtcgcggacaccaagtacgccgac
gtatga

DBGET integrated database retrieval system