KEGG   Streptomyces bingchenggensis: SBI_06568Help
Entry
SBI_06568         CDS       T01678                                 

Definition
putative sugar hydrolase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SBI_06568
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SBI_06568
Enzymes [BR:sbh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SBI_06568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7920486..7922177
Genome map
AA seq 563 aa AA seqDB search
MNLAMNATGLIPAPHRAYELLDGAHYLLDAETLLHAGPGTESTARWLRATVGAATGLPLP
PGEDHDNGVLLRISPEIERELGPEGYRITADGHAIRIEGGGPAGVFWGAQTFRQLLGPDA
FRRAPVVTREEWAVPCGVIEDAPRFGWRGLMLDVARHFMPKGDVLAYVDLLAAHKLNVLH
LHLTDDQGWRIEIRRYPRLTEVGAWRERTKFGHRASPLWDERPHGGYYTQDDIREIVAYA
AERHITVVPEIDIPGHSQAAIAAYPELGNADAVDTASLGVWTTWGVNPNVLSPADTTLRF
YENVLEEVLELFPGGFVHLGGDECPKEQWRASPAAQARIRELGLADEDELQNWFLGHFGR
WLAERGRRLIGWDEILEGSTASALGADLAEGAAVSSWRGYAGGIAAARAGHDVVMCPKQQ
VYFDSRQAAGDDEPVPIGYVRTLEDVFRFEPVPPELTGAEAERVLGAQANVWTEVTEDRR
RVDYQTFPRLAAFAEAVWSTLPPPPERDFTGFQERMAAHYARLDALGVDYRPPGGPRPWQ
RRPAPKGMVGSLGRPIDGSPPIV
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
gtgaacctcgccatgaacgccacaggtctgatcccggcgccgcaccgcgcgtacgagctg
ctggacggcgcccactacctcctggacgccgagaccctgctgcacgccggcccgggcacc
gagtccaccgcccgctggctgcgcgccaccgtcggcgccgcgaccggcctgccgctccca
cccggcgaggatcacgacaacggggtcctcctccggatcagccccgagatcgagcgtgag
ctcggccccgagggctatcgcatcaccgccgacggccacgcgatccggatcgagggcggc
ggcccggccggggtcttctggggcgcgcagaccttccgccaactgctcggccccgacgcc
ttccgccgggcgccggtcgtcacccgggaggagtgggcggtgccctgcggggtgatcgag
gacgccccgcgcttcggctggcgcggtctcatgctggacgtggcgcggcacttcatgccc
aagggcgatgtgctcgcgtacgtcgacctcttggccgcgcacaagctcaatgtgctgcat
ctgcatctgaccgacgaccagggctggcgcatcgagatccgccgctaccccaggctcacc
gaggtcggcgcctggcgcgagcgcaccaaattcgggcaccgcgcctcaccgctgtgggac
gagcgcccgcacggcggctactacacccaggacgacatccgcgagatcgtcgcctacgcc
gccgagcggcacatcaccgtcgtcccggagatcgacatccccggacattcacaggccgcc
atcgccgcgtacccggagctgggcaacgccgacgccgtcgacaccgcctccctcggcgtc
tggaccacttggggcgtcaacccgaacgtactctcacccgccgacaccacgctgcgcttc
tacgagaacgtcctcgaggaggtcctggagctcttcccgggcggcttcgtccacctcggc
ggcgacgagtgccccaaggagcagtggcgggcctccccggccgcccaggcgcggatccgg
gagctgggcctggcggacgaggacgagctgcagaactggttcctgggtcacttcggccgc
tggctggccgagcgcggccgccggctgatcggctgggacgagattctggaaggcagcacc
gccagcgctctgggggccgatctggccgagggcgccgccgtgtcgtcctggcgcggctac
gcgggcggcatcgctgccgcccgcgccggccacgacgtcgtcatgtgccccaaacagcag
gtctacttcgactcccgccaggccgccggcgacgatgagccggtccccatcggctacgtg
cgcaccctggaggatgtctttcgcttcgagccggttccacccgagctcaccggtgcggag
gcggagcgcgtgctcggcgctcaggccaacgtctggacggaggtgacggaggaccggcgg
cgcgtcgactaccagacctttccgcgcctcgccgccttcgccgaagcggtctggtcgacg
cttccgccgccgcccgagcgggacttcaccggcttccaggagcgtatggcggcccactac
gcgcggctggacgcgctcggcgtggactaccggccccccggcggcccgcgtccgtggcag
cggcgccctgcccccaaaggaatggttggcagtctcggacgtccgatcgacgggtcgccc
ccgatcgtgtga

DBGET integrated database retrieval system