KEGG   Streptomyces bingchenggensis: SBI_06869Help
Entry
SBI_06869         CDS       T01678                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K13316  
NDP-hexose 5-epimerase [EC:5.1.3.-]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Polyketide sugar unit biosynthesis
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SBI_06869
Enzymes [BR:sbh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.-  
     SBI_06869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(8223681..8224346)
Genome map
AA seq 221 aa AA seqDB search
MEIHETAVPDAYRIVPRHHTDARGSFFESYAYGQLARQTGHVFVPLQVNYSVSARNTLRG
VHGVRLPPGQAKFVTCVRGALLDVVVDLRLGSPTFGAYDTNMLDADQGTAVYVAEGLGHG
FVALTDDTCISYLCSTQYVPGTQIDLHPLDPALGLPWHLGLTDEPLISEKDARAPSLAEA
ANQGLLATYDTCRIHYERQLRSADAAEPTAHVLAKASRTRR
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggagatccatgagaccgccgtaccggacgcctaccgcatcgtgccgcgccaccacacc
gatgcgcggggcagcttcttcgagtcgtacgcgtacgggcagctggcccggcagaccggc
catgtgttcgtccccttgcaggtcaactactcggtgtcggcccgcaatacgctgcgcggt
gtgcacggtgtgcggctgccgcccggccaggccaagttcgtgacgtgtgtgcgcggggcg
ctgctcgacgtcgtggtggacctgcgtcttggctcgcccaccttcggcgcgtacgacacc
aacatgctcgacgccgaccagggcaccgcggtgtacgtcgccgagggcttgggccacggc
ttcgtggcgctcaccgacgacacctgcatcagctatctgtgctccacgcagtacgtcccc
ggcacccagatcgacctccacccgctcgaccccgcgctcgggctgccgtggcacctcggg
ctcaccgacgaacccctgatctcggagaaggacgcccgcgccccgtccctggccgaggcc
gccaaccagggactgctggccacctacgacacctgccgcatccactacgaacggcagctg
cgctccgccgacgccgccgagcccaccgcgcacgtcctcgcgaaggcgtcgaggacccgc
cggtag

DBGET integrated database retrieval system