KEGG   Streptomyces bingchenggensis: SBI_06918Help
Entry
SBI_06918         CDS       T01678                                 

Gene name
nagZ
Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SBI_06918 (nagZ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SBI_06918 (nagZ)
Enzymes [BR:sbh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SBI_06918 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8281791..8283443
Genome map
AA seq 550 aa AA seqDB search
MARRRIRLSLLCSLLLAVAAGAGTAATASPSDPAAGPAAPGAAAGARPVPLDRVVPAPAS
VRPAKTPYTLGPHTRIQVAPGSRAARQVGDYLAGVLRPSTGYRLPVTAGWSTAPGRGGDA
IRLRLLGTSPSGRGLGTEGYRLEVNRRTITISARGPAGLFHGVQTLRQLLPAAVERNTRQ
SGPWTVSGGTVTDVPRYAYRGAMLDVSRHFFTVGQVKAYIDQLALYKINTLHLHLSDDQG
WRIAIDSWPRLAAYGGSTQVGGGPGGFYSKADYREIVRYAASRYLTVVPEIDMPGHTNAA
LASYAELNCDGVAPPLYTGTEVGFSSLCAPKEVTYDFADDVIREVAALTPGRYLHVGGDE
AHSTSHEDFVAFMDRVQPLVAKYGKTVIGWHQLTGARPAKGAIAQYWGQDGSEKEVADAA
RAGTRLILSPANRAYLDMKYDKDTPLGQDWAGLVDARQSYDWDPGAYIKGAPASSVLGVE
APLWTETLSTSAHLEYMAFPRLPGIAELGWSPSATHDWAGYRVRLAAQGPRWDALGIDYY
RSPQVPWPTR
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggcacgacgccggatccgcctcagcctcctgtgctccctgctgctcgccgtggcggcg
ggagcggggaccgccgccaccgcgagcccatccgatccggccgccggcccagcggcgccc
ggtgccgccgccggggcgcggccggtaccgctggaccgggtcgtgcccgcgcccgcctcc
gtacggcccgcgaagaccccgtacaccctcggcccgcacacccggatccaggtcgccccg
ggttcccgcgcggcgcgccaggtgggcgactatctggcgggcgtgctgcgcccctccacc
gggtaccggctgccggtcaccgcgggctggagcacggcgccgggccgcggcggcgacgcc
atccggctgcggctcctcggcacctcgcccagcgggcgcggcctcgggacggagggctac
cggctggaggtgaaccggcgcacgatcaccatcagcgcccgcgggcccgcggggctgttc
cacggcgtgcagaccctgcggcagctgctgcccgccgcggtcgagcggaacacccggcag
tccggcccctggaccgtctccggcggcaccgtcaccgatgtgccgcgctacgcctaccgc
ggcgcgatgctggatgtgtcccggcacttcttcaccgtcggccaggtcaaggcgtatatc
gaccagctcgcgctgtacaagatcaatacgctgcatctgcatctctcggacgaccagggg
tggcggatcgccatcgactcctggccacggctcgcggcgtacggcggctccacccaggtc
ggcggcgggcccggcggcttctacagcaaggccgactaccgggagatcgtccggtacgcg
gcgagccgctatctgaccgtcgtccccgagatcgacatgccgggccacaccaacgccgcg
ctcgcctcgtacgccgagctgaactgcgacggcgtcgcgcccccgctctacaccggcacc
gaggtcggcttcagctcgctgtgcgcgcccaaggaggtgacgtacgacttcgcggacgat
gtgatccgggaggtcgccgcgctcacccccggccgctatctccacgtcggcggcgacgag
gcgcactccaccagccatgaggacttcgtggccttcatggaccgggtccagccgctcgtc
gccaagtacggcaagacggtgatcggctggcaccagctgaccggcgcccggcccgccaag
ggggccatcgcccagtactgggggcaggacggcagcgagaaggaggtcgcagacgccgcc
agggcgggcacccggctgattctctcgcccgccaaccgcgcctacctggacatgaagtac
gacaaggacacgccgctggggcaggactgggccgggctggtggacgcccggcagtcctac
gactgggacccgggcgcgtatatcaagggcgcgccggcgtcctcggtcctcggggtcgag
gcgccgctgtggacggagaccctgtcgacgagcgcgcacctcgagtacatggccttcccc
cggctcccgggcatcgccgagctcggctggtccccgtccgccacgcacgactgggccggg
taccgggtgcggctggccgcgcaggggccgcggtgggacgcgctcggcatcgactactac
cgctcgccccaggtgccgtggcccacgcgctga

DBGET integrated database retrieval system