KEGG   Streptomyces bingchenggensis: SBI_06918Help
Entry
SBI_06918         CDS       T01678                                 

Gene name
nagZ
Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sbh00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sbh00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8281791..8283443
Genome map
AA seq 550 aa AA seqDB search
MARRRIRLSLLCSLLLAVAAGAGTAATASPSDPAAGPAAPGAAAGARPVPLDRVVPAPAS
VRPAKTPYTLGPHTRIQVAPGSRAARQVGDYLAGVLRPSTGYRLPVTAGWSTAPGRGGDA
IRLRLLGTSPSGRGLGTEGYRLEVNRRTITISARGPAGLFHGVQTLRQLLPAAVERNTRQ
SGPWTVSGGTVTDVPRYAYRGAMLDVSRHFFTVGQVKAYIDQLALYKINTLHLHLSDDQG
WRIAIDSWPRLAAYGGSTQVGGGPGGFYSKADYREIVRYAASRYLTVVPEIDMPGHTNAA
LASYAELNCDGVAPPLYTGTEVGFSSLCAPKEVTYDFADDVIREVAALTPGRYLHVGGDE
AHSTSHEDFVAFMDRVQPLVAKYGKTVIGWHQLTGARPAKGAIAQYWGQDGSEKEVADAA
RAGTRLILSPANRAYLDMKYDKDTPLGQDWAGLVDARQSYDWDPGAYIKGAPASSVLGVE
APLWTETLSTSAHLEYMAFPRLPGIAELGWSPSATHDWAGYRVRLAAQGPRWDALGIDYY
RSPQVPWPTR
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggcacgacgccggatccgcctcagcctcctgtgctccctgctgctcgccgtggcggcg
ggagcggggaccgccgccaccgcgagcccatccgatccggccgccggcccagcggcgccc
ggtgccgccgccggggcgcggccggtaccgctggaccgggtcgtgcccgcgcccgcctcc
gtacggcccgcgaagaccccgtacaccctcggcccgcacacccggatccaggtcgccccg
ggttcccgcgcggcgcgccaggtgggcgactatctggcgggcgtgctgcgcccctccacc
gggtaccggctgccggtcaccgcgggctggagcacggcgccgggccgcggcggcgacgcc
atccggctgcggctcctcggcacctcgcccagcgggcgcggcctcgggacggagggctac
cggctggaggtgaaccggcgcacgatcaccatcagcgcccgcgggcccgcggggctgttc
cacggcgtgcagaccctgcggcagctgctgcccgccgcggtcgagcggaacacccggcag
tccggcccctggaccgtctccggcggcaccgtcaccgatgtgccgcgctacgcctaccgc
ggcgcgatgctggatgtgtcccggcacttcttcaccgtcggccaggtcaaggcgtatatc
gaccagctcgcgctgtacaagatcaatacgctgcatctgcatctctcggacgaccagggg
tggcggatcgccatcgactcctggccacggctcgcggcgtacggcggctccacccaggtc
ggcggcgggcccggcggcttctacagcaaggccgactaccgggagatcgtccggtacgcg
gcgagccgctatctgaccgtcgtccccgagatcgacatgccgggccacaccaacgccgcg
ctcgcctcgtacgccgagctgaactgcgacggcgtcgcgcccccgctctacaccggcacc
gaggtcggcttcagctcgctgtgcgcgcccaaggaggtgacgtacgacttcgcggacgat
gtgatccgggaggtcgccgcgctcacccccggccgctatctccacgtcggcggcgacgag
gcgcactccaccagccatgaggacttcgtggccttcatggaccgggtccagccgctcgtc
gccaagtacggcaagacggtgatcggctggcaccagctgaccggcgcccggcccgccaag
ggggccatcgcccagtactgggggcaggacggcagcgagaaggaggtcgcagacgccgcc
agggcgggcacccggctgattctctcgcccgccaaccgcgcctacctggacatgaagtac
gacaaggacacgccgctggggcaggactgggccgggctggtggacgcccggcagtcctac
gactgggacccgggcgcgtatatcaagggcgcgccggcgtcctcggtcctcggggtcgag
gcgccgctgtggacggagaccctgtcgacgagcgcgcacctcgagtacatggccttcccc
cggctcccgggcatcgccgagctcggctggtccccgtccgccacgcacgactgggccggg
taccgggtgcggctggccgcgcaggggccgcggtgggacgcgctcggcatcgactactac
cgctcgccccaggtgccgtggcccacgcgctga

DBGET integrated database retrieval system