KEGG   Streptomyces bingchenggensis: SBI_06930Help
Entry
SBI_06930         CDS       T01678                                 

Definition
putative agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SBI_06930
Enzymes [BR:sbh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SBI_06930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8296125..8297105
Genome map
AA seq 326 aa AA seqDB search
MTTADRRPLGPVDSSRIPRYAGPATFARLPRIDEVGGAADVAVVGVPFDSGVSYRPGARF
GGNAIREASRLLRPYNPAQDASPFALAQVADAGDIAANPFNINEAVETIQTAADDLLTAG
ARLMTLGGDHTIALPLLRAVARKHGPVALLHFDAHLDTWDTYFGAEYTHGTPFRRAVEEG
ILDTSALSHVGTRGPLYGKQDLDDDAKMGFGIVTSADVMRRGVDEVAQQLRERIGDRPLY
ISIDIDVLDPAHAPGTGTPEAGGLTSRELLEILRGLSSCHLVSADVVEVAPAYDHAEITS
VAASHTAYELTTIMARQIAAGASGGA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagcagaccgccgccccctcggccccgtcgactcctcccgcatcccccgctac
gcgggccccgccaccttcgcccggctgccgcgcatcgacgaggtcggcggcgcggcggac
gtcgccgtggtcggcgtgcccttcgacagcggggtctcctaccgccccggcgcccgcttc
ggcggcaacgccatccgcgaggcgtcccggctgctgcgcccctacaacccggcccaggac
gcctcccctttcgccctcgcccaggtcgccgacgccggggacatcgccgcgaaccccttc
aacatcaacgaggccgtcgagaccatccagaccgccgccgacgacctgctcaccgccggc
gcccgcctgatgaccctcggcggcgaccacaccatcgccctgcccctgctgcgcgccgtc
gcccgtaagcacggcccggtcgccctgctccacttcgacgcccacctcgacacctgggac
acgtacttcggcgccgagtacacccacggcacgcccttccggcgggccgtcgaggaaggc
atcctcgacacctccgccctctcgcacgtcggaacacgcggtccgctctacggaaagcag
gacctggacgacgacgccaagatgggcttcggcatcgtcacctccgccgacgtcatgcgg
cgcggcgtggacgaggtcgcccagcagctgcgcgagcgcatcggcgaccgacccctctac
atctccatcgacatcgacgtcctcgaccccgcccacgcccccggcaccggcacccccgag
gcgggcggcctcacctcccgcgagctcctggagatcctgcgcggcctgtcctcctgccac
ctggtctccgcggacgtcgtcgaggtcgcccccgcgtacgaccacgcggagatcacgtcc
gtggccgcctcccatacggcgtacgagctcacgacgatcatggcccgccagatcgcggcg
ggagcctccggcggcgcctga

DBGET integrated database retrieval system