KEGG   Streptomyces bingchenggensis: SBI_06951Help
Entry
SBI_06951         CDS       T01678                                 

Definition
putative sugar hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sbh  Streptomyces bingchenggensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SBI_06951
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    SBI_06951
Enzymes [BR:sbh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SBI_06951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8321683..8323596)
Genome map
AA seq 637 aa AA seqDB search
MHDPAFPKAASRRTLLTAALAAAAAACSPQRTSAAREASPTHRATDPAGGGAQRRDRDRD
RKRAEALLGRMTLDEKIGQLFVVRVYGHSATSPAPADAAQNRRETGVATAAELIAKYHAG
GVMYVGWAHNIRDPHQLAALSNGIQKAALAGHTPVPALLSIDQEHGIVARIGAPATLLPG
AMALGAGGSAADARTAARIAGAELAALGIRQDYAPVADVNVDPANPVIGVRSFGADPKAV
ARLVAAQIEGYQSAGVAATAKHFPGHGDTSVDSHLDLPLITHSRAQWERLDAPPFRAAIA
AGVDAIMTAHLRFPALDPRDGPATLSKPILTGVLRGELGFGGVVVTDSLGMAGVRKKYGD
DRVPVLALKAGADQLLNPPDLPAAWAGVHRAVRSGELSEARIEESVLRILELKARRGLLD
HPYTGDGQVARTVGSRGHRAAADRIAERTTTLLVNDGHLLPLSPRRHRRLLVVGPDPAAP
SGTGGPPTAVLARALTALGFTAEALSTGAGPDPTPERIKAAVAAARGRDAVIVATYNVGK
DSRQRALVSELAATGVPLVHVALRNPYDIAYIAWLTGAPGKAPAASLATYSWTDVELRAA
ARVIAGRTGPRGRLPVPVRRADEPSRVLYPVGHGLSY
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
gtgcacgacccggcattccccaaggcggcctcccgccgcaccctgctgaccgctgccctc
gcggcggcggccgccgcctgttccccacagcggacctccgccgcccgggaggcctcgccg
acccatcgcgccaccgacccggccggcggcggcgcccaacgccgggaccgggaccgcgac
cgcaagcgggccgaggcgctgctgggtcggatgaccctcgacgagaagatcggccagctc
ttcgtggtgcgggtctacggccattcggccacctcccccgcccccgccgacgccgcgcag
aaccgcagggagaccggtgtcgccaccgccgccgagctgatcgcgaagtaccacgccggc
ggcgtcatgtacgtggggtgggcgcacaacatccgcgacccccaccagctcgccgccctc
tccaacggcatccagaaggccgcgctcgcgggccacacccccgtccccgcgctgctctcc
atcgaccaggagcacggcatcgtggcccgcatcggcgcgcccgccaccctcctcccgggc
gcgatggcgctcggcgccgggggcagcgccgccgacgcccgtaccgccgcccggatagcc
ggggccgagctcgccgcgctcggcatccggcaggactacgcgcccgtcgcggacgtcaac
gtcgacccggccaaccccgtcatcggcgtacgctccttcggcgccgacccgaaggccgtg
gcccggctggtcgcggcccagatcgagggctaccagagcgccggggtcgcggccaccgcc
aagcacttccccgggcacggcgacacgtccgtggacagccatctcgacctcccgctcatc
acccactcccgcgcgcagtgggagcggctggacgcacccccgttccgggccgccatcgcg
gcgggcgtcgacgcgatcatgacggcgcatctgcggttccccgcgctcgacccccgcgac
ggccccgccacgctctccaagcccatcctcaccggtgtgctgcgcggcgaactcggcttc
ggcggcgtggtggtgacggattcgctcggcatggccggggtgcggaagaagtacggcgac
gaccgggtgcccgtgctggccctgaaggcgggcgcggaccagctgctgaacccgccggac
ctgccggccgcctgggcgggcgtccaccgggccgtacggagcggcgagctcagcgaggcc
cgtatcgaggaatccgtgctgcgcatcctggaactcaaggcgcgccggggcctgttggac
catccgtacaccggcgacggccaggtcgcccgtacggtcggcagccgcgggcaccgcgcc
gccgccgaccggatcgccgagcgcaccaccacgctgctcgtcaacgacggccacctgctg
ccgctgtccccccgccgccaccgcaggctgctggtcgtgggcccggacccggccgcgccc
tccggcaccggcggcccgccgacggcggtcctcgcccgcgccctgaccgccctcggcttc
accgccgaggccctgtccaccggcgccgggcccgacccgacgccggagcggatcaaggcg
gcggtcgcggcggcgcgggggcgggacgcggtgatcgtggcgacgtacaacgtcggcaag
gactcccggcagcgcgccctcgtctccgagctcgccgccacgggcgtacccctggtgcat
gtggcgctccggaacccctatgacatcgcgtacatcgcgtggctgaccggcgccccgggc
aaggcccccgcggcctccctggccacctactcctggacggacgtcgaactgcgcgccgcc
gcccgggtcatcgcgggccggaccggcccgcgcggcaggctgcccgtccccgtacggcgc
gcggacgagccgtcgcgggtgctgtacccggtgggccacgggctgtcgtactga

DBGET integrated database retrieval system