KEGG   Streptomyces bingchenggensis: SBI_07002Help
Entry
SBI_07002         CDS       T01678                                 

Definition
exodeoxyribonuclease V
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SBI_07002
Enzymes [BR:sbh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SBI_07002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8377127..8379337
Genome map
AA seq 736 aa AA seqDB search
MLKLAVVEGVLERITYANEENGYTVARVDTGRGSGDLLTVVGSLLGAQPGESLRMEGRWG
SHPQYGKQFTVENYTTVLPATVQGIRRYLGSGLIKGIGPVFADRITEHFGLDTLQIIEEE
PKRLIEVPGLGPKRTKKIADAWEEQKAIKEVMLFLQTVEVSTSIAVRIYKKYGDASISVV
KNEPYRLAADVWGIGFLTADKIAQSVGIPHDSPERVKAGLQYALSQSTDNGHCFLPEEQL
IADSVKLLQVDTGLVIECLAELADEEGVVRESVPGPDGGEPVTAVYLVPFHRAEISLAGQ
TLRLLRGAEDRMPAFQDVDWDKALAWLARHTGADLAPEQSQAVRLALTEKVAVLTGGPGC
GKSFTVRSVVELARAKKAKVVLAAPTGRAAKRLAELTGAEASTVHRLLELKPGGDAAYDR
DRPLDADLVVVDEASMLDLLLANKLVKAVPPGAHLLFVGDVDQLPSVGAGEVLRDLLADG
SPVPAVRLTRIFRQAQQSGVVTNAHRINSGVPPITHGMPDFFLFAEEDTEAAGKLTVDVA
ARRIPAKFGLDPRRDVQVLAPMHRGPAGAGTLNGLLQQSITPARPDLPERRFGGRIFRVG
DKVTQIRNNYEKGANGVFNGTVGVVTSLDSDEQRLTVLTDEDEEVAYDFDELDELAHAYA
VTIHRSQGSEYPAVVIPVTTGAWMMLQRNLLYTAVTRAKRLVVLVGSRRALGQAVRTVSA
GRRCTALDHRLGSFST
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaactcgcggtggtcgaaggggtcctggagcggatcacctacgccaatgaggag
aacggctatacggtcgcccgggtcgacaccggccgcggctccggggatctgctcaccgtc
gtcggctcgctgctgggcgcgcagcccggcgagtcgctgcggatggagggccgctggggc
tcccacccgcagtacggcaagcagttcaccgtcgagaactacaccaccgtgctgcccgcc
accgtccagggcatccggcgctatctgggctccggcctgatcaagggcatcgggcccgtc
ttcgccgaccgcatcaccgagcacttcggcctggacaccctgcagatcatcgaggaggag
ccgaagcggctgatcgaggtccccggcctcggcccgaagcgcacgaagaagatcgccgat
gcctgggaggagcagaaggcgatcaaggaggtcatgctcttcctccagacggtggaggtg
tccacgtccatcgccgtgcggatctacaagaagtacggcgacgcctcgatctcggtcgtg
aagaacgagccgtaccggctggccgccgatgtctggggcatcggctttctgaccgccgac
aagatcgcccagtccgtcggcatcccgcatgacagccccgagcgggtgaaagccggattg
cagtacgcgctgtcccagtcgacggacaacggccactgcttcctccccgaggagcaactg
atcgcggactcggtcaagttgctccaggtcgacaccggcctggtcatcgagtgcctggcc
gagctggccgacgaggagggcgtggtgcgcgagagcgtgccgggcccggacggcggcgag
ccggtcacggccgtgtatctggtgccctttcaccgcgccgagatctccctcgcaggtcag
acgctgcggctgctgcgcggcgcggaggaccgtatgcccgccttccaggacgtggactgg
gacaaggcgctggcctggctcgcccggcacaccggggccgatctggcccccgagcagagc
caggcggtgcggctcgcgctgaccgagaaggtcgcggtgctgaccggcgggccgggctgc
ggcaagtccttcacggtgcggtccgtggtggagctggcgcgcgccaagaaggccaaggtg
gtgctcgcggcccccaccggccgggccgccaagcggctcgccgagctgaccggcgccgag
gcgtccacggtccaccggctgctggagctcaagcccggcggggacgcggcgtacgaccgg
gaccggccgctggacgccgatctggtggtggtggacgaggcgtccatgctcgatctgctg
ctggccaacaaactggtcaaggcggtcccgccgggcgcccatctgctcttcgtcggggat
gtggaccagctgccgagcgtcggcgcgggcgaggtgctgcgcgatctgctggccgacggc
agccccgtcccggcggtgcggctgaccaggatcttccgccaggcccagcagtccggcgtg
gtcaccaacgcccaccggatcaactccggcgtgccgccgatcacccacggcatgcccgac
ttcttcctgttcgccgaggaggacaccgaggccgccgggaagctcacggtggatgtggcg
gcccgtcggatccccgccaagttcggcctcgacccgcgccgggatgtgcaggtcctggcc
ccgatgcaccgtggcccggcgggcgccgggacgctcaacggcctcctccagcagtccatc
acccccgcccggccggatctgcccgagcggcgcttcggcggccggatcttccgcgtcggc
gacaaggtcacccagatccgcaacaattatgagaaaggggccaatggggtcttcaatggc
acggtgggcgtcgtcacctccctcgacagcgatgagcagcgcctgaccgtgctgaccgac
gaggacgaggaggtggcgtacgacttcgacgagctggacgagctggcacacgcctatgcg
gtgaccatccaccgctcacagggcagcgagtacccggccgtggtcatcccggtgaccacc
ggcgcctggatgatgctgcagcgcaatctgctgtatacggcggtgacccgcgccaagcgc
ctggtggtgctcgtcggctcgcgccgcgccctgggacaggcggtgcggacggtgtcggcg
ggcaggaggtgcaccgcactggaccaccggctcggctcgttcagcacctga

DBGET integrated database retrieval system