KEGG   Streptomyces bingchenggensis: SBI_07082Help
Entry
SBI_07082         CDS       T01678                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SBI_07082
Enzymes [BR:sbh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SBI_07082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8469601..8471889
Genome map
AA seq 762 aa AA seqDB search
MGRALLAELHGVATSYEPAPGRTVRVPDDTVVAVLAALGVDASTPHSVQAALERHEREER
DRLLPPCVVVRPGRPPRLRLPEGTVLRVEPEDGAHGAALDWRPAADGPASSALPLGRHTV
HAHAPDGGSATATLIVAPDRMPTPPARSHGFLVQLYSLLSARSWGMGDLGDLADLAAWSG
RALGAGFVQLNPLHAAVPGTPAEPTDPSPYRPSSRRFPDPVHLRVEDVPEYAQLRGPARD
RVDQLLERAAALRTAVLHEGALIDRDAVWALKREALELVRTVPLSPGRRAAYCDFLAERG
QALEDHAIWSALAELHGPAWRAWPDGLADPRSAAVARARGEHLDRADFHCWLAWLTDGQL
AAAQRAALDAGMAIGLVHDLAVGVHPSGADAWALRDVFASGMSIGAPPDAFNSRGQDWGL
PPWRPDALAATGYAVYRDLLRGLLRHAGALRIDHVMGLFRLWWVPEGREPTEGCYVRYDA
EAMLGVLALEAYRAGAVVIGEDLGTVEPGVREALAGRGVLGTSVLWFERNYNGEGGGAAA
TGEDGGNSGIGGDSETSEVNGASGGDASTQPRDTAPARARPLRPEEWRADCLATVTTHDL
PSTAARLTGGHVELRHRLGLLTRPFARERAEEAVELAEWLGLLGRLGMLPEGPGDEEAAV
KAVHRFLLRTPAKLVGVWLPDTVGDRRPQNLPGTWDQYPNWRLPIADATGRPVSLEDLVA
SPRLHALMGEVVWMARGGGAAGPRGKPTPGTRGARASDTVSP
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgggcagagcgctcctcgccgagctgcacggcgtcgccacctcctacgagcccgccccc
ggccgcaccgtgcgggtgcccgacgacaccgtcgtcgccgtgctcgccgcgctcggcgtg
gacgcttcgacccctcactccgtacaggccgctctggagcggcacgagcgcgaggagcgc
gaccggctgctgccgccctgcgtggtggtgcgccccggccggccgccacggctgcggctc
cccgagggcaccgtgctgcgggtggaacccgaggacggcgcgcacggcgcggcgctcgac
tggcggcctgccgccgacggcccggcgtcctccgcgctccccctgggccgccacaccgtg
cacgcccacgcccccgacggcggttcggccaccgccaccctgatcgtcgcccccgaccgg
atgccgacgcccccggcgcgcagccacggcttcctcgtccagctgtactcgctgctgtcc
gcgcgctcctgggggatgggcgacctcggcgatctggccgacctcgccgcctggtcgggc
cgggcgctgggcgccgggttcgtccagctcaacccgctgcacgcggccgtgcccggcaca
ccggccgagcccaccgacccctcgccgtaccgcccctcctcgcgccgcttccccgacccg
gtccacttacgggtcgaggacgtgcccgagtacgcccagctgcgcggccccgcgcgcgac
cgcgtcgaccagctgctggagcgggccgccgcgctgcgcacggccgtgctccacgagggc
gcgctgatcgaccgggacgcggtgtgggcgctcaagcgggaggccctggagctggtgcgg
accgtgccgctcagccccggccgccgggccgcctactgcgacttcctggccgagcgcggc
caggccctcgaggaccacgcgatctggagcgcgctcgccgagctccacggccccgcctgg
cgcgcctggccggacggcctggccgacccccggtccgccgcggtcgcccgcgcccggggc
gagcacctggaccgggccgacttccactgctggctcgcctggctgacggacgggcagctg
gccgccgcgcagcgcgccgcgctcgacgccgggatggccatcggcctggtgcacgacctg
gcggtcggggtgcatccgtcgggcgccgacgcctgggcgctgcgggacgtcttcgcgtcc
gggatgtcgatcggcgcgccgccggacgcgttcaactcccgcggccaggactgggggctg
ccgccgtggcgcccggacgccctggccgccacgggctacgccgtctaccgcgatctgctg
cgcgggctgctgcggcacgcgggcgcgctgcgcatcgatcatgtgatgggcctgttccgg
ctgtggtgggtgccggaggggcgggagccgaccgagggctgttacgtccgctacgacgcg
gaggccatgctcggtgtgctcgcgctggaggcgtatcgcgcgggggcggtggtcatcggc
gaggacctgggcacggtggagccgggggtgcgggaggcgctggcggggcggggggtgctg
ggcacgtcggtgctgtggttcgagcggaactacaacggcgagggcggcggcgccgccgcg
accggcgaggacggcgggaacagcgggatcggcggggacagcgagaccagcgaggtcaac
ggggcgagcggcggcgacgcgagtacgcagccccgggacaccgcgccggcccgtgcccgt
ccgctgaggcccgaggagtggcgcgccgactgtctggccaccgtcaccacccacgatctg
ccgagcaccgccgcccgcctcaccggcggccatgtcgagctgcggcaccggctcggcctg
ctcacccgcccgttcgcgcgcgagcgggccgaggaggcggtggagctcgcggagtggctg
gggctgctggggcggctggggatgctgccggaggggccgggcgacgaggaggcggccgtc
aaggcggtccaccgctttttgctgcgcaccccggcgaaactggtcggcgtgtggctgccg
gacacggtgggggaccggcgcccgcagaacctccccgggacctgggaccagtatccgaac
tggcggctgcccatcgcggacgcgaccggccgccccgtatcgctggaggatctggtggcc
tcgccacggctgcatgccctgatgggcgaggtggtgtggatggcacggggcgggggcgcg
gccggtccccggggcaagcccaccccgggcacgcggggcgcgagggcgtccgataccgtg
agtccgtga

DBGET integrated database retrieval system