KEGG   Streptomyces bingchenggensis: SBI_07129Help
Entry
SBI_07129         CDS       T01678                                 

Definition
predicted gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sbh01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sbh00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8535102..8536199
Genome map
AA seq 365 aa AA seqDB search
MSEQDGSAAVRDEVAAARRIVVKVGSSSLTTAAGGLDADRVDALVDVLAKFADGPGAPGA
PGGPGGAEGKEIVLVSSGAIAAGLAPLGLERRPRDLARQQAAASVGQGLLVARYTASFAR
YGRRVGQVLLTTDDTSRRAHYRNATRTLDQLLAMGAVPIVNENDTVATDEIRFGDNDRLA
ALVAHLVRADLLVLLSDVDGLYDGDPRTPGTSRIAEVTGPKDLDGVSIGSAGRSGVGTGG
MVTKVEAARIAAAAGVPVVLTSASRAGDALLGRPTGTFFHRTTAPAAAPPTGCCGWRTPP
RRAGRSPWTTVRCGPWWSAVPRCCRPVSPPWRASSPRGTRSSCATPRGGPSPVGWSTSTP
RRSPG
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagcaggacgggtcggctgcggtacgggacgaggtggccgcggcccgcaggatc
gtggtcaaggtcggttcgtcctccctcaccaccgcggcgggaggtctggacgccgaccgg
gtcgacgcgctggtggacgtcctcgccaaattcgcagacggcccaggcgccccaggcgcc
ccaggcggccccggcggcgcggagggcaaggagatagtcctggtctcctccggcgccatc
gccgcgggcctggcgccgctgggtctcgaacggcgcccgcgcgacctcgcccgtcagcag
gccgccgccagcgtcggccagggcctgctggtggcccgctacaccgcctccttcgcgcgc
tacgggcgccgggtcggccaggtgctgctcaccaccgacgacaccagccgccgcgcccac
taccgcaacgccacccgcaccctggaccagctgctggccatgggggccgtgccgatcgtc
aacgagaacgacacggtggccacggacgagatccggttcggcgacaacgaccggctcgcg
gccctggtcgcccatctggtgcgggccgatctgctggtgctgctctccgatgtggacggc
ctctacgacggggatccccgcacccccggcacctcccggatcgccgaggtcaccggcccc
aaggacctggacggcgtctcgatcggcagtgcgggccgctccggggtgggcaccggcggc
atggtcaccaaggtcgaggcggcccggatcgcggccgcggccggtgtcccggtggtgctg
acctccgccagccgggccggtgacgccctgctgggccgccccaccggcacgttcttccac
cgcaccaccgccccggccgccgctccgccgaccggctgctgtggctggcgcacgcctccg
cgccgcgcggggcgctcaccctggacgacggtgcggtgcgggccgtggtggagcgccgta
cctcgctgctgccggccggtatcgccgccgtggagggcgagttcaccgcgggggacccgg
tcgagctgcgcgacaccgaggggcgggccgtcgcccgtgggctggtcaacttcgacgcca
aggagatcccccggctga

DBGET integrated database retrieval system