KEGG   Streptomyces bingchenggensis: SBI_07129Help
Entry
SBI_07129         CDS       T01678                                 

Definition
predicted gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SBI_07129
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SBI_07129
Enzymes [BR:sbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SBI_07129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8535102..8536199
Genome map
AA seq 365 aa AA seqDB search
MSEQDGSAAVRDEVAAARRIVVKVGSSSLTTAAGGLDADRVDALVDVLAKFADGPGAPGA
PGGPGGAEGKEIVLVSSGAIAAGLAPLGLERRPRDLARQQAAASVGQGLLVARYTASFAR
YGRRVGQVLLTTDDTSRRAHYRNATRTLDQLLAMGAVPIVNENDTVATDEIRFGDNDRLA
ALVAHLVRADLLVLLSDVDGLYDGDPRTPGTSRIAEVTGPKDLDGVSIGSAGRSGVGTGG
MVTKVEAARIAAAAGVPVVLTSASRAGDALLGRPTGTFFHRTTAPAAAPPTGCCGWRTPP
RRAGRSPWTTVRCGPWWSAVPRCCRPVSPPWRASSPRGTRSSCATPRGGPSPVGWSTSTP
RRSPG
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagcaggacgggtcggctgcggtacgggacgaggtggccgcggcccgcaggatc
gtggtcaaggtcggttcgtcctccctcaccaccgcggcgggaggtctggacgccgaccgg
gtcgacgcgctggtggacgtcctcgccaaattcgcagacggcccaggcgccccaggcgcc
ccaggcggccccggcggcgcggagggcaaggagatagtcctggtctcctccggcgccatc
gccgcgggcctggcgccgctgggtctcgaacggcgcccgcgcgacctcgcccgtcagcag
gccgccgccagcgtcggccagggcctgctggtggcccgctacaccgcctccttcgcgcgc
tacgggcgccgggtcggccaggtgctgctcaccaccgacgacaccagccgccgcgcccac
taccgcaacgccacccgcaccctggaccagctgctggccatgggggccgtgccgatcgtc
aacgagaacgacacggtggccacggacgagatccggttcggcgacaacgaccggctcgcg
gccctggtcgcccatctggtgcgggccgatctgctggtgctgctctccgatgtggacggc
ctctacgacggggatccccgcacccccggcacctcccggatcgccgaggtcaccggcccc
aaggacctggacggcgtctcgatcggcagtgcgggccgctccggggtgggcaccggcggc
atggtcaccaaggtcgaggcggcccggatcgcggccgcggccggtgtcccggtggtgctg
acctccgccagccgggccggtgacgccctgctgggccgccccaccggcacgttcttccac
cgcaccaccgccccggccgccgctccgccgaccggctgctgtggctggcgcacgcctccg
cgccgcgcggggcgctcaccctggacgacggtgcggtgcgggccgtggtggagcgccgta
cctcgctgctgccggccggtatcgccgccgtggagggcgagttcaccgcgggggacccgg
tcgagctgcgcgacaccgaggggcgggccgtcgcccgtgggctggtcaacttcgacgcca
aggagatcccccggctga

DBGET integrated database retrieval system