KEGG   Streptomyces bingchenggensis: SBI_07341Help
Entry
SBI_07341         CDS       T01678                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sbh00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sbh00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sbh00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8750353..8752581)
Genome map
AA seq 742 aa AA seqDB search
MTGTASEVASDGAQEAFTWGHARLTAHFATGVDGVVRLVRLTIPDGEGAPPEQPSADQDP
GPGGPHPAPLPLVEVLALGHGSEWSGQRGIETALGARLRHRGHRAVRDGQDERDGQGWHR
LTIDLHDPDTGLTAEVRLSSPDGLPVLRAEVRLTNEGTAPLTVQAVTSLTLGGLPSPDTL
DVHLARNDWLAECRWASEPLRTRIVDLSRDAHQHDSRAALALHSRGGWPSDGHLPMGALT
DRTTGDAWLWQIESPTGWRWETGERAHGTYAALHGPTDAEHQWRERLAPGASFTTVPAAL
ALARGGGLDEALAHLTAYRRATRRPHPDHTTLPVVFNDYMNTLMGDPTTERLLPLIDAAA
EAGAEYFCIDSGWYDDDAQGWWDSVGAWQPSARRFPGGGIQAVLDHIRSRGMVPGLWLEP
EVVGVRSPVAAELPADAFFQRDGIRLVEHGRHHLDLRHPAARAHLDKTIDRIAGEWGVGY
LKLDYNISVAPGTDWHPETGRTAPGAGLLAHARAYQDWLAATLDRHPGLVIENCASGGMR
MDWSSVALTQLQSTSDQQDPLRYPPIAASAPTAVPPEQGAVWAYPQPEFTDDEIDFTLAG
ALLGRIHLSGHLDRMSPRQLARVQWAIAAYRRLRGDLATGVPFWPLGLPGWDDAWVALGV
RSGETAYVTVWRREGGPAECTLPLGHLAGRPAEVEVLHPAAASGAEARWDAGQGELMVTL
PRTPMALLVRLTPADPADQAVF
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
ttgaccggtacggcatccgaggtggcgtcagacggcgcccaggaagcgttcacttggggc
cacgcgcggctcacggcccacttcgcgacgggcgtcgacggggtggtgcggctcgtacgg
ctgacgattccggacggcgaaggggcgccccctgagcagccctccgccgaccaggacccc
ggccccggcggcccccaccccgccccgctgccgctcgtcgaagtgctggccctcggccac
ggcagcgagtggtccgggcagcgcggcatcgagaccgcgctcggcgcccggctgcgccac
cggggccaccgggccgtacgggacgggcaggacgagcgcgacggacagggctggcatcgg
ctgacgatcgacctccacgacccggacaccggcctgaccgccgaggtccggctctcctcc
cccgacgggctgccggtgctgcgcgccgaggtccggctcaccaacgagggcaccgccccg
ctgaccgtccaggccgtcaccagcctcaccctcggcgggctcccctcccccgacacgctc
gatgtgcacctggcccgcaacgactggctcgccgaatgccgttgggcgagcgaacccctg
cgcacccggatcgtcgacctcagccgggacgcccaccagcacgacagccgcgccgccctc
gccctccacagccgcggcggctggccgtccgacggccatctgcccatgggcgcgctgacc
gaccgcaccaccggcgacgcatggctgtggcagatcgagtcgccgaccggctggcggtgg
gagaccggggagcgggcccacggtacgtacgccgcgctccacgggccgaccgacgccgag
caccagtggcgcgaacggctcgcccccggcgcgtcgttcaccaccgtccccgccgcgctg
gcgctcgcccggggcggcggcctcgacgaggccctggcccacctcaccgcctaccgccgc
gccacccgccgcccgcaccccgaccacaccaccctgcccgtggtgttcaacgactacatg
aacaccctcatgggcgaccccaccaccgagcgcctgctgccgctgatcgacgccgccgcc
gaggccggggcggagtacttctgcatcgactccggctggtacgacgacgacgcacagggc
tggtgggacagcgtcggcgcctggcagccctcggcccgccgcttccccggcggcggcatc
caggccgtactggaccacatccgctcccgcggcatggtcccggggctgtggctggagccc
gaggtcgtcggcgtacgcagccccgtcgccgccgaactgcccgccgacgccttcttccaa
cgcgacgggatccgcctcgtcgaacacggccgccaccacctcgatctgcgccacccggcc
gcccgcgcccacctcgacaagaccatcgaccgcatcgccggcgaatggggcgtcggctac
ctcaagctcgactacaacatcagcgtggcgccgggcaccgactggcaccccgaaaccggc
cgcaccgcccccggcgcgggcctcctcgcccacgcccgcgcctaccaggactggctggcc
gccacgctcgaccgccaccccgggctcgtcatcgagaactgcgcctcgggcgggatgcgc
atggactggtcctcggtggccctcacccaactccagtccaccagcgaccagcaggacccg
ctccgctacccgcccatcgccgcctcggcgcccacggcggtgccaccggagcagggcgcg
gtatgggcctacccgcagcccgaattcaccgacgacgagatcgacttcactctcgcgggc
gccctgctgggccgcatccacctctccggccacctcgaccggatgtcaccgcggcagctg
gcccgggtgcagtgggccatcgcggcgtaccggcggctgcggggcgatctggccaccggg
gtgccgttctggccgctggggctgccggggtgggacgacgcctgggtggcgctgggggtg
cgcagcggtgagacggcctatgtgacggtatggcgccgggaaggcggcccggcggagtgc
acgctgccgctcgggcacttggcgggccgtccggcggaggtcgaggtgctgcacccggcc
gccgcctcgggcgccgaggctcggtgggacgcggggcagggcgagttgatggtgaccttg
ccgcgtacgccgatggcgctgctggtccggctgacgcccgccgaccccgccgaccaggcc
gtgttttag

DBGET integrated database retrieval system