KEGG   Streptomyces bingchenggensis: SBI_07398Help
Entry
SBI_07398         CDS       T01678                                 

Definition
family 36 glycoside hydrolase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SBI_07398
  Lipid metabolism
   00561 Glycerolipid metabolism
    SBI_07398
   00600 Sphingolipid metabolism
    SBI_07398
Enzymes [BR:sbh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SBI_07398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8810521..8812737)
Genome map
AA seq 738 aa AA seqDB search
MFELGDLTVRYPRHDAAGDGGARTAIGAEAAIGLEIFPTELADHLAPPRDRLPGDAARHH
PDTGPARHIEPLAAVARAGDPVPEPFAGVRTLRRTATTAALRLRAQRATTTDTGTETTTD
TGTEIVTELSDGQGLLVVHRLTHRPGDPFIRIRTRAANEGDRPFALDLISSFTLGGITPF
AADDAPGRLVVHRIRSAWSAEARLVSATAEQLHLERPWVNIGTVAERFGAPGSMPAAGWM
PWLAVEDTEAGVVWGVQLAAGGPWQLELLRSRDGLAIGGGPADHDFGHWRRTLSPGESYE
APEAVVTAVHGDLDALCARLTRAWAGHPRPGPERTSSLPAMFNEYATTWGNPTHDRILAL
ADRLQSSGVRYFVIDCGWFSEPGEDWGRSHGDWTPSAERFPHGLAETARQLRERGFVPGL
WWEPETTGELSRAYKDASRHIAYDGVPVHVSARRFLDLRRPEVAEPLLDRMTALLSEGGF
GYLKIDYNAHLGPGDDGEGLRELTAASRGFIARLSARLPDLVIENCAGGGHRIDPAYAAL
TAVSSGSDAFEAREAPAIAAGLQRVLLPRQSLVWATVRADDSDAALVYKLAAGFLGRICL
SGDPDRLDERQWALVREALDLYGRAAPLIDDGTTRQGGTRGAALRNAVGWQSVVRLSPDG
RRALVVLHAFADPDESLSVTLPDEGVKAGVGSGADRGAAWTLDAWLLADGTGALSLAGDR
LRWQRPPEWSGAVALLSR
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagctgggagatctgaccgtccggtatccgcgccacgacgcggcgggcgacggc
ggcgcgcggaccgcgatcggggccgaggccgcgatcggcctcgagatcttcccgaccgag
ctggccgaccacctggcaccaccccgcgaccgcctgccgggggacgccgcccgccaccac
cccgacaccggccccgcccgccacatcgaaccgctggcggcggtggcccgcgccggggac
cccgtacccgagcccttcgcgggcgtacgcaccctgcggcggacggccacgacggcggcg
ctgcggctacgggcgcagcgggcgaccacgacggacaccggcacggagaccacgacggac
accggcacggagatcgtcaccgaactgtccgacggtcagggcctgttggtcgtccaccgg
ctgacccaccgccccggcgaccccttcatacggatccgcaccagggccgccaacgagggc
gaccgccccttcgccctcgacctgatctcgtccttcacccttggcggcatcacccccttc
gccgccgacgacgcccccggccgcctcgtcgtccaccgcatccgctccgcctggagcgcc
gaggcccggctggtcagcgcgaccgccgagcaactgcacctggagcggccctgggtcaac
atcggcaccgtggcggagcgtttcggcgcgcccgggtcgatgcccgcggcgggctggatg
ccctggctggccgtcgaggacaccgaggccggggtggtgtggggcgtccagctggcggcg
ggcggcccctggcagctggagctgctgcgctcccgcgacgggctggccatcggcggcggc
cccgcggaccacgacttcggccactggcgccgcaccctttcgcccggcgagtcgtacgag
gcgcccgaggccgtcgtcaccgccgtccacggcgacctggacgcgctctgcgcccggctc
acccgcgcctgggccggccatccgcggcccggccccgaacggacgtcatcgctgccggcg
atgttcaacgagtacgcgacgacctggggcaaccccacccacgaccggatcctggccctc
gccgaccgcctccagagctccggcgtacggtacttcgtcatcgactgcggctggttcagc
gagcccggcgaggactggggccgcagccacggcgactggacgcccagcgccgaacgcttt
ccgcacggactcgccgaaaccgccaggcagctgcgcgagcgcggtttcgtacccgggctg
tggtgggagccggagacgacgggcgagctgtcgcgggcgtacaaggacgcgtcgcgccac
atcgcatacgacggcgtccccgtgcatgtgtccgcccgccgcttcctggatctgcgccgc
cccgaggtcgccgaaccgctgctggaccggatgaccgcgctgctgagcgagggcggcttc
ggctatctcaagatcgactacaacgcgcatctgggccccggcgacgacggcgagggcctg
cgcgaactcaccgccgcctcccgcggcttcatcgcccggctctccgcccggttgcccgac
ctcgtcatcgagaactgcgcgggcggcggccaccgcatcgaccccgcgtacgccgcgctc
accgccgtctcctcgggctcggacgccttcgaggcccgcgaggccccggcaatcgcggcc
gggctgcagcgcgtgctgctcccccgccagtcgctggtgtgggcgaccgtacgggccgac
gactccgacgccgcgctcgtatacaagctggccgcggggttcctcggacggatctgcctg
tccggcgacccggaccggctcgacgaacggcagtgggcgctggtgcgcgaggcgctggac
ctgtacgggcgggccgcgccgctcatcgacgacgggacgacgcggcagggcggcacccgc
ggtgccgccctgcgcaacgccgtcggctggcagtccgtcgtacggctgtcccccgacggc
cgacgcgccctggtcgtgctgcacgccttcgccgacccggacgagtcgctgtcggtgacg
ctcccggacgagggcgtcaaggccggcgtgggcagcggggccgacaggggcgcggcctgg
acgctggacgcctggctcctcgccgacggcaccggcgcgctctccctcgccggggatcgg
ctgcgctggcagcggcccccggagtggtcgggcgcggtggctctgctcagccgttag

DBGET integrated database retrieval system