KEGG   Streptomyces bingchenggensis: SBI_07430Help
Entry
SBI_07430         CDS       T01678                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBI_07430
   00052 Galactose metabolism
    SBI_07430
Enzymes [BR:sbh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SBI_07430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8844865..8846010)
Genome map
AA seq 381 aa AA seqDB search
MTAAAAAGLAATAVATGTGTAYAKDAKGGGRAVKEHFGTLADGTKVDRWTIENGRTRLSV
LTYGGIVQSLEIPDRHGRMANVSLGFADLDSYVAGSPYFGALIGRYGNRIANGKFTLDGH
AYQLPVNDGPNSLHGGDKGFDKRVWSIEPFEDGGNVGLTLRRVSSDGEMGYPGKLTVRVD
YTLTSAGDWHIDYEATTDKPTVVNLTNHTYYNLGGEGTGSIYDHRLQIAASRYTPVNKTL
IPTGELAKVAGTPFDFRRSKAVGRDIREAHQQVLYGQGIDHNFVLDKGITSRPEHIVTVS
EPESGRVMRIATTEPGVQFYTGNFLVGTLAGTSGQVYRQGDGFCLETQHFPDSPNQPSFP
STVLRPGETYRSTTVHSFSTR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgacggcggcagcggccgccgggctggcagccacggccgtcgctacggggacgggcacg
gcttacgcgaaggacgcgaagggcggcggacgcgcggtgaaggaacacttcggaacgctg
gctgacggcaccaaggtcgaccgctggacgatcgagaacggccgcacccggctctccgta
ctcacctacggcggcatcgtccagtccctggagatccccgaccgccacggccgcatggcc
aatgtgtcgctgggcttcgccgacctggactcgtacgtggccggcagcccgtacttcggc
gccctgatcggccgctacggcaaccgcatcgcgaacggcaagttcaccctcgacggccac
gcctaccaactccccgtcaacgacggccccaacagcctccacggcggggacaagggcttc
gacaagcgcgtctggtccatcgagccgttcgaggacggcggcaacgtcggcctgaccctg
cgccgggtcagctccgacggcgaaatgggctaccccgggaagctgacggtacgcgtcgac
tacaccctcacctcggcgggcgactggcacatcgactacgaggccacgaccgacaagccc
acggtcgtcaacctcaccaaccacacctactacaacctgggaggcgagggcaccggctcc
atctacgaccaccggctccagatcgccgcctcccgctacaccccggtcaacaagaccctc
atcccgaccggcgaactggccaaggtggccggcacgccgttcgacttccgtcggtcgaag
gcggtcggccgggacatccgcgaggcgcaccagcaggtgctctacgggcaggggatcgac
cacaacttcgtcctggacaagggcatcacgagccgtcccgaacacatcgtgacggtcagc
gagccggagtcgggccgggtgatgcggatcgcgaccaccgagccgggtgtgcagttctac
accggcaacttcctggtcgggacgctggcgggcacatcggggcaggtctaccggcagggc
gacggcttctgcctggagacccagcacttccccgactcgcccaaccagcccagcttcccg
tccacggtgctgcggccgggagagacataccggtcgacgacggtgcactcgttctcgacg
cgctga

DBGET integrated database retrieval system