KEGG   Streptomyces bingchenggensis: SBI_07659Help
Entry
SBI_07659         CDS       T01678                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sbh00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sbh00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sbh02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9083822..9085444
Genome map
AA seq 540 aa AA seqDB search
MAHHPHQQAIRAAAARLGRRRFLTVTGAAAAIAFSTNLPSAHATEQTSHALSDDPFTLGV
ASGDPLPDAVVLWTRLAPRPYEPGNGLPDEGFVYVGWEIAHDERFRRVVRKGKTVAHAEF
NYTVHVDAKGLDADRVYWYRFRAGHFTSPAGRTRTAPATGAHVREGRFGLVSCQAYHDGY
FTAYGHLANEDLDAVFHVGDYQYEYAVNSVGGARNYTDRTIPALFNTETITLDQYRLRYA
LYKSDEDLQAAHAAFPWYVTWDDHETENNYAGDIDENGNPPEEFLIRRAAAYRAYWENMP
LRMPQQPDGPDMRLYRRFHYGRLAQFDILDTRQYRSNQAYGDGWQYPGPESEDPSRTLTG
AAQERWLLDGFRRSKATWNVLPQQVTFSQRKNTTAASSKLSMDSWDGYPASRERILAGVE
AAGIENFVVLTGDVHVHYAFDIKKDFNDPTSRTLGVEFVGTSISSGKDGSEKPSNWATYM
AANPHMKFYNGRRGYVTVTLDGEAARADYKTVAGVTAPGAPLTTAASFVSEAGNPGLQDA
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggcacaccacccgcatcagcaggccatacgagccgcggcagcgcgcctgggccgccgc
cgcttcctcaccgtcaccggggccgccgcggccatcgccttcagcaccaacctgcccagc
gcccacgccaccgagcagacctcgcacgccctgagcgacgaccccttcaccctcggcgtg
gcctccggcgatccgctgccggacgccgtcgtgctgtggaccagactcgccccgcgcccg
tacgagccgggcaacggactgcccgacgagggcttcgtgtacgtcggctgggagatcgcc
cacgacgagcgcttcagacgagtggtccgcaagggcaagaccgtcgcgcacgccgagttc
aactacaccgtgcacgtcgacgccaagggcctcgacgccgaccgcgtctactggtaccgc
ttccgcgccggccacttcaccagccccgccggccgcacccgcaccgcccccgccaccggc
gcccacgtccgcgagggccgcttcggcctggtctcctgccaggcgtaccacgacggctac
ttcaccgcctacggccacctggccaacgaggacctggacgccgtcttccacgtcggcgac
taccagtacgagtacgccgtcaactcggtcggcggcgcgcgcaactacaccgaccgcacc
attcccgcgctcttcaacaccgagaccatcaccctcgaccagtaccggctgcgctacgcc
ctctacaagtccgacgaggacctccaggccgcgcacgccgccttcccgtggtacgtcacc
tgggacgaccacgagaccgagaacaactacgcgggcgacatcgacgagaacgggaacccg
ccggaggagttcctgatccgccgggccgccgcctaccgcgcgtactgggagaacatgccg
ctgcgcatgccccagcagcccgacggccccgatatgcggctctaccgccgcttccactac
ggcaggctcgcccagttcgacatcctcgacacccgccagtaccgctccaaccaggcgtac
ggggacggctggcagtacccggggcccgagtccgaggacccctcgcgcaccctcaccggc
gccgcccaggagcgctggctgctcgacggcttccggcgctccaaggccacctggaacgtg
ctcccgcagcaggtcaccttctcgcagcggaagaacaccaccgccgccagctccaagctc
agcatggactcctgggacggctaccccgcctcccgtgagcggatcctcgcgggcgtcgag
gcggccgggatcgagaacttcgtcgtcctcaccggcgacgtccacgtccactacgccttc
gacatcaagaaggacttcaacgaccccacgtcccgcaccctgggcgtggagttcgtcggc
acctccatcagcagcggcaaggacggctccgagaagccgtccaactgggccacgtacatg
gcggccaacccgcatatgaagttctacaacggccgccgcggctatgtgacggtcaccctg
gacggcgaagccgcccgggccgactacaagacggtcgccggagtcaccgcgccgggcgcg
ccgctcaccacggcggcgtcgttcgtcagcgaggccggcaaccccggcctccaggacgcc
tga

DBGET integrated database retrieval system