KEGG   Streptomyces bingchenggensis: SBI_07726Help
Entry
SBI_07726         CDS       T01678                                 

Definition
pyridoxal-5'-phosphate-dependent protein subunit beta
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SBI_07726
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SBI_07726
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SBI_07726
Enzymes [BR:sbh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SBI_07726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9160518..9161732)
Genome map
AA seq 404 aa AA seqDB search
MHPESNHPEPAPAAEPHYLDERSGARYPLTDPRWCGDDGAPLTVSPLPGITRDDVDTGTR
SLWRYRAALPVDIAAPVSLGEGCTPLVEKVWGEVPVRFKLEWFSPTGSFKDRGTSVMISL
LAQRGVPEVIEDSSGNGGASVAAYCAAAGIRATILAPEATSPAKVLQSRAYGARVELVPG
DRDATAAEALRRSERTYYASHNWHPFFLQGTKTLAYELWEDLGFAAPDNVVTVAGAGSTV
LGCDIGFSELLASGQIRRRPRLLVAQPANCAPIHAAFHAQGPAPFAPTVAEGTAIREPIR
LPEVVQAVRRSDGDMAAIPEDEIATAVRRLAAMGLYAEPTSATAAAAIDVFRARGAIRPG
ETTVVLLTGSGLKAATAMNALFTDQGFTDQGFTDQGFADQGGRP
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccctgaatccaaccacccggaaccggcccccgcggcagaaccccactacctggac
gagcgatccggcgcccgctacccgctcaccgacccgcgctggtgcggcgacgacggcgcc
ccgctgaccgtctcccccctgcccggcatcacccgcgacgacgtggacaccggcacccgt
tcgctgtggcgctaccgcgcggccctgcccgtggacatcgccgccccggtgtcgctcggc
gagggctgcaccccgctggtcgagaaggtctggggcgaggtcccggtccgcttcaagctg
gagtggttcagccccaccggcagcttcaaggaccgcggcaccagcgtgatgatctccctc
ctggcgcagcggggcgtaccggaggtcatcgaggacagctccggcaacggcggcgcctcc
gtcgcggcgtactgcgcggccgccggcatccgggccacgatcctcgcccccgaggccacc
tcccccgccaaggtgctccagagccgcgcgtacggggcgcgggtcgagctcgtcccgggc
gaccgggacgccaccgcggcggaggcgctgcgccggtcggagcgtacgtactacgcgagc
cacaactggcacccgttctttctgcagggcaccaagaccctcgcgtacgagctgtgggaa
gacctgggcttcgcggccccggacaatgtcgtcaccgtggccggcgccggctccaccgtg
ctgggctgcgacatcggcttctccgagctgctggcctccggccagatccggcgccgcccc
cggctgctcgtcgcccagcccgccaactgcgcccccatccacgcggcgttccacgcacag
ggccccgcccccttcgcccccaccgtcgccgagggcaccgccatccgcgagcccatccgg
ctgccggaggtcgtccaggcggtccgccgctcggacggcgacatggcggccatccccgag
gacgagatcgccaccgcggtccgccggctggccgccatgggcctgtacgcggagccgacc
agcgcgaccgcggccgccgcgatcgacgtcttccgcgcccggggcgcgatccgccccggc
gagacgaccgtcgtactgctgacgggctcgggactcaaggcggcgaccgcgatgaacgcc
ctcttcaccgatcaaggcttcaccgaccaaggtttcaccgaccaaggcttcgccgatcag
ggaggcagaccatga

DBGET integrated database retrieval system