KEGG   Streptomyces bingchenggensis: SBI_07726Help
Entry
SBI_07726         CDS       T01678                                 

Definition
(RefSeq) pyridoxal-5'-phosphate-dependent protein subunit beta
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SBI_07726
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SBI_07726
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SBI_07726
Enzymes [BR:sbh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SBI_07726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9160518..9161732)
Genome map
AA seq 404 aa AA seqDB search
MHPESNHPEPAPAAEPHYLDERSGARYPLTDPRWCGDDGAPLTVSPLPGITRDDVDTGTR
SLWRYRAALPVDIAAPVSLGEGCTPLVEKVWGEVPVRFKLEWFSPTGSFKDRGTSVMISL
LAQRGVPEVIEDSSGNGGASVAAYCAAAGIRATILAPEATSPAKVLQSRAYGARVELVPG
DRDATAAEALRRSERTYYASHNWHPFFLQGTKTLAYELWEDLGFAAPDNVVTVAGAGSTV
LGCDIGFSELLASGQIRRRPRLLVAQPANCAPIHAAFHAQGPAPFAPTVAEGTAIREPIR
LPEVVQAVRRSDGDMAAIPEDEIATAVRRLAAMGLYAEPTSATAAAAIDVFRARGAIRPG
ETTVVLLTGSGLKAATAMNALFTDQGFTDQGFTDQGFADQGGRP
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccctgaatccaaccacccggaaccggcccccgcggcagaaccccactacctggac
gagcgatccggcgcccgctacccgctcaccgacccgcgctggtgcggcgacgacggcgcc
ccgctgaccgtctcccccctgcccggcatcacccgcgacgacgtggacaccggcacccgt
tcgctgtggcgctaccgcgcggccctgcccgtggacatcgccgccccggtgtcgctcggc
gagggctgcaccccgctggtcgagaaggtctggggcgaggtcccggtccgcttcaagctg
gagtggttcagccccaccggcagcttcaaggaccgcggcaccagcgtgatgatctccctc
ctggcgcagcggggcgtaccggaggtcatcgaggacagctccggcaacggcggcgcctcc
gtcgcggcgtactgcgcggccgccggcatccgggccacgatcctcgcccccgaggccacc
tcccccgccaaggtgctccagagccgcgcgtacggggcgcgggtcgagctcgtcccgggc
gaccgggacgccaccgcggcggaggcgctgcgccggtcggagcgtacgtactacgcgagc
cacaactggcacccgttctttctgcagggcaccaagaccctcgcgtacgagctgtgggaa
gacctgggcttcgcggccccggacaatgtcgtcaccgtggccggcgccggctccaccgtg
ctgggctgcgacatcggcttctccgagctgctggcctccggccagatccggcgccgcccc
cggctgctcgtcgcccagcccgccaactgcgcccccatccacgcggcgttccacgcacag
ggccccgcccccttcgcccccaccgtcgccgagggcaccgccatccgcgagcccatccgg
ctgccggaggtcgtccaggcggtccgccgctcggacggcgacatggcggccatccccgag
gacgagatcgccaccgcggtccgccggctggccgccatgggcctgtacgcggagccgacc
agcgcgaccgcggccgccgcgatcgacgtcttccgcgcccggggcgcgatccgccccggc
gagacgaccgtcgtactgctgacgggctcgggactcaaggcggcgaccgcgatgaacgcc
ctcttcaccgatcaaggcttcaccgaccaaggtttcaccgaccaaggcttcgccgatcag
ggaggcagaccatga

DBGET integrated database retrieval system