KEGG   Streptomyces bingchenggensis: SBI_07726Help
Entry
SBI_07726         CDS       T01678                                 

Definition
(GenBank) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00260  Glycine, serine and threonine metabolism
sbh00750  Vitamin B6 metabolism
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
sbh01120  Microbial metabolism in diverse environments
sbh01230  Biosynthesis of amino acids
Module
sbh_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SBI_07726
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SBI_07726
Enzymes [BR:sbh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SBI_07726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADI10846
UniProt: D7CCZ9
Position
complement(9160518..9161732)
Genome map
AA seq 404 aa AA seqDB search
MHPESNHPEPAPAAEPHYLDERSGARYPLTDPRWCGDDGAPLTVSPLPGITRDDVDTGTR
SLWRYRAALPVDIAAPVSLGEGCTPLVEKVWGEVPVRFKLEWFSPTGSFKDRGTSVMISL
LAQRGVPEVIEDSSGNGGASVAAYCAAAGIRATILAPEATSPAKVLQSRAYGARVELVPG
DRDATAAEALRRSERTYYASHNWHPFFLQGTKTLAYELWEDLGFAAPDNVVTVAGAGSTV
LGCDIGFSELLASGQIRRRPRLLVAQPANCAPIHAAFHAQGPAPFAPTVAEGTAIREPIR
LPEVVQAVRRSDGDMAAIPEDEIATAVRRLAAMGLYAEPTSATAAAAIDVFRARGAIRPG
ETTVVLLTGSGLKAATAMNALFTDQGFTDQGFTDQGFADQGGRP
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccctgaatccaaccacccggaaccggcccccgcggcagaaccccactacctggac
gagcgatccggcgcccgctacccgctcaccgacccgcgctggtgcggcgacgacggcgcc
ccgctgaccgtctcccccctgcccggcatcacccgcgacgacgtggacaccggcacccgt
tcgctgtggcgctaccgcgcggccctgcccgtggacatcgccgccccggtgtcgctcggc
gagggctgcaccccgctggtcgagaaggtctggggcgaggtcccggtccgcttcaagctg
gagtggttcagccccaccggcagcttcaaggaccgcggcaccagcgtgatgatctccctc
ctggcgcagcggggcgtaccggaggtcatcgaggacagctccggcaacggcggcgcctcc
gtcgcggcgtactgcgcggccgccggcatccgggccacgatcctcgcccccgaggccacc
tcccccgccaaggtgctccagagccgcgcgtacggggcgcgggtcgagctcgtcccgggc
gaccgggacgccaccgcggcggaggcgctgcgccggtcggagcgtacgtactacgcgagc
cacaactggcacccgttctttctgcagggcaccaagaccctcgcgtacgagctgtgggaa
gacctgggcttcgcggccccggacaatgtcgtcaccgtggccggcgccggctccaccgtg
ctgggctgcgacatcggcttctccgagctgctggcctccggccagatccggcgccgcccc
cggctgctcgtcgcccagcccgccaactgcgcccccatccacgcggcgttccacgcacag
ggccccgcccccttcgcccccaccgtcgccgagggcaccgccatccgcgagcccatccgg
ctgccggaggtcgtccaggcggtccgccgctcggacggcgacatggcggccatccccgag
gacgagatcgccaccgcggtccgccggctggccgccatgggcctgtacgcggagccgacc
agcgcgaccgcggccgccgcgatcgacgtcttccgcgcccggggcgcgatccgccccggc
gagacgaccgtcgtactgctgacgggctcgggactcaaggcggcgaccgcgatgaacgcc
ctcttcaccgatcaaggcttcaccgaccaaggtttcaccgaccaaggcttcgccgatcag
ggaggcagaccatga

DBGET integrated database retrieval system