KEGG   Streptomyces bingchenggensis: SBI_07836Help
Entry
SBI_07836         CDS       T01678                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SBI_07836
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBI_07836
   00052 Galactose metabolism
    SBI_07836
   00500 Starch and sucrose metabolism
    SBI_07836
   00520 Amino sugar and nucleotide sugar metabolism
    SBI_07836
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SBI_07836
   00524 Butirosin and neomycin biosynthesis
    SBI_07836
Enzymes [BR:sbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SBI_07836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9288134..9289075
Genome map
AA seq 313 aa AA seqDB search
MGLTIGVDIGGTKIAAGVVDEEGSILETCKVSTPQTPEGVVDAIAGAVREVSTGHDIEAV
GIGAAGYVDDKRATVLFAPNINWRHEALKDKVEQRVGLPVVVENDANAAAWGEYRFGAGQ
GHDDVVCITLGTGLGGGIIIGGKLHRGRFGVAAEFGHIRVVPDGLLCGCGSQGCWEQYAS
GRALVRYAKQRANATPESAEVLLGLGDGTPEGIQGKHISDAARQGDPVAIDSFRELARWA
GAGLADLASLFDPSAFIVGGGVSDEGDLVLEPIRKSFRRWLVGNQWRPHAQVLAAQLGGK
AGLVGAADLARQG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgggactcaccatcggcgtcgacatcggcggcacgaagatcgcagctggcgtggtcgac
gaagagggctcgattctcgagacgtgcaaggtatcgaccccgcagactcccgagggggtc
gtcgacgccatcgccggcgcggtgcgtgaggtcagcaccggccatgacatcgaggccgtc
ggcatcggcgccgccggttacgtggacgacaagcgcgccacggtgctcttcgcgcccaac
atcaactggcgtcatgaagcgctcaaggacaaggtcgagcagcgcgtgggcctccccgtc
gtcgtcgagaacgacgcgaacgccgcggcgtggggcgagtaccgcttcggcgccggccag
ggccatgacgacgtcgtgtgcatcacactcggcaccggcctcggcggcggcatcatcatc
ggcggcaagctgcaccgcggccgcttcggcgtggccgccgagttcggccatatccgcgtg
gtccctgacgggctgctgtgcggctgcggcagccagggctgctgggagcagtacgcctcc
ggccgcgccctggtccgctacgccaagcagcgcgccaacgccaccccggagagcgccgag
gtgctgctcggcctcggcgacggcacccccgagggcatccagggcaagcacatcagcgac
gccgcccgccagggcgacccggtcgccatcgactccttccgcgaactggcccgctgggcc
ggcgccggcctcgccgacctggcctcgctcttcgacccctcggcgttcatcgtcggcggc
ggcgtctcggacgagggcgatctggtcctcgagccgatccgcaagtccttccgccgctgg
ctggtcggcaatcagtggcgtccgcacgcccaggtgctcgccgcccagctcggcggcaag
gccgggctcgtcggcgccgccgacctggcccgccagggctga

DBGET integrated database retrieval system