KEGG   Streptomyces bingchenggensis: SBI_07839Help
Entry
SBI_07839         CDS       T01678                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sbh  Streptomyces bingchenggensis
Brite
Enzymes [BR:sbh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SBI_07839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9290584..9291414)
Genome map
AA seq 276 aa AA seqDB search
MPLLPGAQPFRHDGGEIGVLVCHGFTGSPQSVRPWAEHLARQGLTVSLPLLPGHGTRWQE
LAITSREDWYAEVDRELYGLAARCRHVFVCGLSMGGALALRLAARHGARVSGIALVNPAH
KMHDRAAPALPVLRHLVPSVKGIVSDIAKPGTPESGYDRVPLNGAYQLRRLLQEVDGELP
RVTQPLLLMHSAQDHVVPPVDSARILSRVSSRDVTELVLERSYHVATLDHDAELIFAETH
AFISRLARGIDQDSGDADPGTDMRLGKEGAAASGGA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtgccgctcctccccggggcccagccgttccgccacgacggcggagagatcggcgtcctc
gtctgtcatggcttcaccggctcaccccaatcggtccgcccctgggccgagcaccttgcg
cggcagggcctgacggtctcgctgccgctgctgcccggccacggcacccgctggcaggag
cttgcgatcaccagccgggaggactggtacgccgaggtggaccgggagctgtacgggctc
gccgcgcggtgccggcacgtgttcgtctgcgggctgtccatgggcggcgcgctcgccctg
cggctggccgccaggcacggggcgcgggtcagcgggatcgccctggtcaacccggcccac
aagatgcacgaccgggcggccccggcgctgccggtgctgcgccatctggtcccctccgtc
aagggcatcgtgagcgatatcgcgaagccgggcacgccggagtcgggctatgaccgggtg
ccgctgaacggcgcgtaccagctgcgccggctgctccaggaagtggacggcgagctgcca
cgggtgacccagccgctgctgctgatgcacagtgcgcaggaccatgtggtgccgccggtc
gactcggcgcgcatcctgagccgggtctcctcccgggatgtcaccgagctggtgctggag
cgcagctaccacgtggcgacgctggaccacgacgcggagctcatcttcgccgagacccat
gcgttcatcagcaggctggcgcggggtatcgatcaggacagcggggatgcggaccccggg
acggatatgcgactcgggaaggagggggcggcggccagtggcggagcgtga

DBGET integrated database retrieval system