KEGG   Streptomyces bingchenggensis: SBI_07843Help
Entry
SBI_07843         CDS       T01678                                 

Gene name
pfkA3
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SBI_07843 (pfkA3)
   01230 Biosynthesis of amino acids
    SBI_07843 (pfkA3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBI_07843 (pfkA3)
   00030 Pentose phosphate pathway
    SBI_07843 (pfkA3)
   00051 Fructose and mannose metabolism
    SBI_07843 (pfkA3)
   00052 Galactose metabolism
    SBI_07843 (pfkA3)
  Energy metabolism
   00680 Methane metabolism
    SBI_07843 (pfkA3)
Enzymes [BR:sbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SBI_07843 (pfkA3)
Protein phosphatases and associated proteins [BR:sbh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SBI_07843 (pfkA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9294665..9295693
Genome map
AA seq 342 aa AA seqDB search
MRVGVLTGGGDCPGLNAVIRAVVRKGVQGYGYDFVGFRDGWRGPLEGDTVTLDIQAVRGI
LPRGGTILGSSRTNPLKSQDGIRRVKENLAKEEVDALIAIGGEDTLGVAARLSGEYGIRC
VGVPKTIDNDLSATDYTFGFDTAVNIATEAIDRLHTTAESHMRVLVVEVMGRHAGWIALH
SGLAGGANVILIPEQRFDVDQICAWVESRFKIRYAPIVVVAEGAMPKGGDAVLKDGSLDS
FGHVRLSGIGEWLAKEIERRTGKEARTTVLGHVQRGGTPSAFDRWLATRFGLHAIDAVRD
EDYGKMVALRGTDIVRVPLAEATARLKTVDLSLYAEAEVFFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtcggagtgctgaccggtggcggtgactgccccgggctcaacgcggttatccgc
gccgtcgtccgcaagggcgtgcagggatacggctacgacttcgtcggcttccgggacggc
tggcgcggtccgctcgagggcgacaccgtgaccctcgacatccaggccgtgcgcggcatc
ctgccgcgcggcggcacgattctcgggtcctcccgcaccaaccccctcaagagccaggac
ggcatccgccgggtcaaggaaaacctcgccaaggaggaagtcgacgcgctgatcgcgatc
ggcggcgaggacacgctcggggtggccgcgcggctgtccggcgagtacgggatccgctgc
gtcggcgtccccaagaccatcgacaacgacctgtccgccaccgactacaccttcggcttc
gacaccgccgtcaacatcgccaccgaggccatcgaccgcctccacaccacggccgagtcg
catatgcgcgtcctcgtcgtggaggtgatgggccgtcacgcgggctggatcgccctccat
tccgggctggccggcggcgccaacgtcatcctcatccccgagcagcgcttcgacgtggac
cagatctgcgcctgggtcgagtcccgcttcaagatccgttacgccccgatcgtcgtcgtc
gcggagggcgccatgcccaagggcggcgacgcggtcctcaaggacgggtcgctcgactcc
ttcggccatgtccggctctccggtatcggcgagtggctggccaaggagatcgagaggcgc
accggcaaggaggcccgcaccaccgtcctcggccacgtccagcgcggcggcacccccagc
gccttcgaccgctggctcgccacccgcttcgggctgcacgccatcgacgccgtccgggac
gaggactacggcaagatggtcgcgctgcgcggcaccgacatcgtccgcgtccccctcgcg
gaggccaccgcacggctgaagaccgtggacctctccctgtacgccgaggccgaggtcttc
ttcggctga

DBGET integrated database retrieval system