KEGG   Streptomyces bingchenggensis: SBI_07941Help
Entry
SBI_07941         CDS       T01678                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SBI_07941 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SBI_07941 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SBI_07941 (trpB)
Enzymes [BR:sbh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SBI_07941 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
9398798..9400030
Genome map
AA seq 410 aa AA seqDB search
MPSDFFVPDPEGRIPTAEGYFGAFGGQFIPEALVAAVDEVAVEYDKVKSDPSFAAELEDL
LVNYTGRPSALTEVPRFAEHAGGARIFLKREDLNHTGSHKINNVLGQALLAKRMGKTRVV
AETGAGQHGVATATACALFGLECVVYMGEIDTERQALNVARMRILGAEVVSVKTGSRTLK
DAINEAFRDWVANVDRTHYLFGTVAGPHPFPALVRDFQRVIGVEARRQILERVGRLPDAA
VACVGGGSNAMGLFHAFLKDESVRLIGFEPAGHGVETGEHAATLTKGEPGILHGSRSYVL
QDEDGQILEPYSISAGLDYPGVGPEHSYLKDTGRAEYRAITDDAAMQALRLLSRTEGIIP
AIESAHALAGALELGRELGGDGLVLINLSGRGDKDMDTAARYFGLYEGEK
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctgacttctttgttccggacccggagggtcgtatccccaccgccgaggggtat
ttcggcgcgttcggcggccagttcatccccgaggcgctggtcgccgcggtggatgaggtc
gccgttgagtacgacaaggtgaagagcgatccgtcgttcgccgccgagctcgaggatctg
ctggtcaactacacggggcggcccagcgccctgaccgaggtgccgcggttcgcggaacat
gcggggggtgcgcggatctttctcaagcgggaggatctcaaccacaccggatcccacaag
atcaacaacgtgctgggccaggcgctgctcgccaagcgcatgggcaagacccgggtggtc
gccgagaccggtgccgggcagcacggcgtggcgacggctaccgcgtgtgcgctgttcggg
ctcgagtgcgtggtctacatgggggagatcgacaccgagcgccaggcgctcaacgtcgcg
cgtatgcggatcctgggcgccgaggtcgtctccgtgaagacgggcagccggacgctcaag
gacgcgatcaatgaggcgttccgcgactgggtggccaacgtggaccgtacgcactatctg
ttcgggaccgtcgccggaccgcatccgttcccggcgctggtgcgcgacttccaacgggtg
atcggcgtggaggcgcggcggcagatcctggagcgggtcgggcggctgccggacgcggcg
gtggcgtgtgtcggaggcgggtcgaacgccatggggctcttccacgccttcctgaaggac
gagtccgtgcggctgatcggcttcgagccggccgggcacggcgtggagacgggggagcac
gcggccacgctgacgaagggggagccggggattctgcacggctcccggtcgtatgtgctg
caggacgaggacgggcagatcctggagccgtattcgatctcggccggtctggactatccg
ggggtcggcccggagcactcgtatctgaaggacacggggcgggccgagtaccgggcgatc
accgatgacgccgcgatgcaggcgctgcggctgctgtcgcggaccgaggggatcatcccg
gcgatcgagagcgcgcacgccctggcgggggcgctggagctggggcgtgagctgggcggc
gacgggttggtgctgatcaatctgtcgggccggggcgacaaggacatggacacggccgcg
cggtatttcgggctctacgagggagagaagtga

DBGET integrated database retrieval system