KEGG   Streptomyces bingchenggensis: SBI_07942Help
Entry
SBI_07942         CDS       T01678                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SBI_07942 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SBI_07942 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SBI_07942 (trpA)
Enzymes [BR:sbh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SBI_07942 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
9400030..9400839
Genome map
AA seq 269 aa AA seqDB search
MSAELLGSVLAKAKGEGRAALVGYWPAGYPTVDDGVRAMTAMVEGGCDVIEVGLPYSDPV
LDGPVIQTADDIALRGGVRIRDVIRTVGEVHAATGAPVLIMTYWNPVDRYGVERFAADLA
AVGGAGCILPDLPVQESEAWRKAAEQHGLATVFVVAQSSGDERLAKITAAGSGFVYAASI
MGVTGTRDSVGEGARELVARTRATTSLPVCVGLGVSNARQAAEVAEYADGVIVGTAFVRR
LMDAEDLETGLTAVRDLAGELAEGVRIPR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcagagctgctggggtccgtgctggcgaaggccaagggggaggggcgcgccgcg
ctcgtcggctactggccggccggctatccgacggtcgacgacggagtgcgggcgatgacg
gcgatggtcgagggcggctgcgatgtgatcgaggtcggcctgccgtacagcgatccggtg
ctggacggtccggtcatccagaccgccgacgacatcgcgctgcggggcggtgttcgcatc
cgcgatgtgatccgtacggtcggcgaggtgcatgccgcgacgggggcgcccgtcttgatc
atgacgtactggaatccggtggaccggtacggcgtggagcggttcgccgccgatctggcc
gcggtgggcggggcgggctgcatcctgcccgatctgccggtccaggagtcggaggcgtgg
cggaaggccgccgagcagcatgggctggcgacggtcttcgtggtggcccagagcagcggt
gacgagcggctggcgaagatcaccgcggcgggcagcggctttgtgtacgcggcctcgatc
atgggcgtcaccggcacccgcgactcggtgggggagggggcgcgggagctggtggcgcgc
acccgtgcgacgacctcgctgccggtgtgtgtggggctcggggtgtccaatgcccggcag
gccgccgaggtggccgagtacgcggacggcgtcatcgtcgggacggcgttcgtgcggcgg
ctgatggacgccgaggacctggagacggggcttacggccgtccgggacctggcgggtgag
ctggcggagggcgtccgcatcccccggtag

DBGET integrated database retrieval system