KEGG   Streptomyces bingchenggensis: SBI_08031Help
Entry
SBI_08031         CDS       T01678                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00010  Glycolysis / Gluconeogenesis
sbh00051  Fructose and mannose metabolism
sbh00562  Inositol phosphate metabolism
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
sbh01120  Microbial metabolism in diverse environments
sbh01130  Biosynthesis of antibiotics
sbh01200  Carbon metabolism
sbh01230  Biosynthesis of amino acids
Module
sbh_M00002  Glycolysis, core module involving three-carbon compounds
sbh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBI_08031 (tpiA)
   00051 Fructose and mannose metabolism
    SBI_08031 (tpiA)
   00562 Inositol phosphate metabolism
    SBI_08031 (tpiA)
Enzymes [BR:sbh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SBI_08031 (tpiA)
Exosome [BR:sbh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SBI_08031 (tpiA)
  Exosomal proteins of bladder cancer cells
   SBI_08031 (tpiA)
  Exosomal proteins of melanoma cells
   SBI_08031 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADI11151
UniProt: D7CGS1
Position
9510824..9511600
Genome map
AA seq 258 aa AA seqDB search
MSDRTPLMAGNWKMNLNHLEAIAHVQKITFSLTDKDYEDVEVAVLPPFTDLRTLQTLVEH
DKLKLKYGAQDISAHGSGAYTGEISGAMLAKLRCSYVAVGHSERRQYHGETDELCNAKVK
AAFKNDVTPILCVGEGLDVRKAGNQVAHTLAQIDGGLKDIPAEQAERIVIAYEPVWAIGT
GEVATPEDAQEVCGAIRGRLAELYSQDVADKVRIQYGGSVKSGNVAAIMAQPDVDGALIG
GAALDADEFVKIVRFRDQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaccgcaccccgctgatggcgggcaactggaagatgaacctcaaccacctcgag
gccatcgcccacgtccagaagatcactttctcgctcaccgacaaggactacgaggacgtc
gaggtcgcggtccttccgccgttcacggacctccggaccctgcagaccctggtcgagcac
gacaagctcaagctcaagtacggcgcccaggacatctcggcgcacggctccggcgcgtac
accggggagatctccggcgcgatgctcgccaagctgcggtgctcctatgtggcggtcggc
cactccgagcggcgccagtaccacggcgagaccgacgagctgtgcaacgccaaggtcaag
gccgccttcaagaacgacgtcacccccatcctgtgcgtcggcgagggcctggacgtgcgc
aaggcgggcaaccaggtcgcccacacgctcgcgcagatcgacgggggcctgaaggacatc
ccggccgagcaggccgagcggatcgtgatcgcgtacgagccggtctgggccatcggcacc
ggtgaggtggccacccccgaggacgcccaggaggtctgcggggccatccggggccgcctg
gccgagctgtacagccaggacgtggccgacaaggtccggatccagtacggcggctcggtg
aagtccggaaacgtcgccgcgatcatggcgcagccggacgtggacggcgcgctgatcggc
ggcgcggcgctggacgcggacgagttcgtcaagatcgtccggttccgcgaccagtga

DBGET integrated database retrieval system