KEGG   Streptomyces bingchenggensis: SBI_08031Help
Entry
SBI_08031         CDS       T01678                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SBI_08031 (tpiA)
   01230 Biosynthesis of amino acids
    SBI_08031 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBI_08031 (tpiA)
   00051 Fructose and mannose metabolism
    SBI_08031 (tpiA)
   00562 Inositol phosphate metabolism
    SBI_08031 (tpiA)
Enzymes [BR:sbh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SBI_08031 (tpiA)
Exosome [BR:sbh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SBI_08031 (tpiA)
  Exosomal proteins of bladder cancer cells
   SBI_08031 (tpiA)
  Exosomal proteins of melanoma cells
   SBI_08031 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9510824..9511600
Genome map
AA seq 258 aa AA seqDB search
MSDRTPLMAGNWKMNLNHLEAIAHVQKITFSLTDKDYEDVEVAVLPPFTDLRTLQTLVEH
DKLKLKYGAQDISAHGSGAYTGEISGAMLAKLRCSYVAVGHSERRQYHGETDELCNAKVK
AAFKNDVTPILCVGEGLDVRKAGNQVAHTLAQIDGGLKDIPAEQAERIVIAYEPVWAIGT
GEVATPEDAQEVCGAIRGRLAELYSQDVADKVRIQYGGSVKSGNVAAIMAQPDVDGALIG
GAALDADEFVKIVRFRDQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaccgcaccccgctgatggcgggcaactggaagatgaacctcaaccacctcgag
gccatcgcccacgtccagaagatcactttctcgctcaccgacaaggactacgaggacgtc
gaggtcgcggtccttccgccgttcacggacctccggaccctgcagaccctggtcgagcac
gacaagctcaagctcaagtacggcgcccaggacatctcggcgcacggctccggcgcgtac
accggggagatctccggcgcgatgctcgccaagctgcggtgctcctatgtggcggtcggc
cactccgagcggcgccagtaccacggcgagaccgacgagctgtgcaacgccaaggtcaag
gccgccttcaagaacgacgtcacccccatcctgtgcgtcggcgagggcctggacgtgcgc
aaggcgggcaaccaggtcgcccacacgctcgcgcagatcgacgggggcctgaaggacatc
ccggccgagcaggccgagcggatcgtgatcgcgtacgagccggtctgggccatcggcacc
ggtgaggtggccacccccgaggacgcccaggaggtctgcggggccatccggggccgcctg
gccgagctgtacagccaggacgtggccgacaaggtccggatccagtacggcggctcggtg
aagtccggaaacgtcgccgcgatcatggcgcagccggacgtggacggcgcgctgatcggc
ggcgcggcgctggacgcggacgagttcgtcaagatcgtccggttccgcgaccagtga

DBGET integrated database retrieval system