KEGG   Streptomyces bingchenggensis: SBI_08031Help
Entry
SBI_08031         CDS       T01678                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:sbh01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sbh01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sbh00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sbh00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:sbh00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9510824..9511600
Genome map
AA seq 258 aa AA seqDB search
MSDRTPLMAGNWKMNLNHLEAIAHVQKITFSLTDKDYEDVEVAVLPPFTDLRTLQTLVEH
DKLKLKYGAQDISAHGSGAYTGEISGAMLAKLRCSYVAVGHSERRQYHGETDELCNAKVK
AAFKNDVTPILCVGEGLDVRKAGNQVAHTLAQIDGGLKDIPAEQAERIVIAYEPVWAIGT
GEVATPEDAQEVCGAIRGRLAELYSQDVADKVRIQYGGSVKSGNVAAIMAQPDVDGALIG
GAALDADEFVKIVRFRDQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaccgcaccccgctgatggcgggcaactggaagatgaacctcaaccacctcgag
gccatcgcccacgtccagaagatcactttctcgctcaccgacaaggactacgaggacgtc
gaggtcgcggtccttccgccgttcacggacctccggaccctgcagaccctggtcgagcac
gacaagctcaagctcaagtacggcgcccaggacatctcggcgcacggctccggcgcgtac
accggggagatctccggcgcgatgctcgccaagctgcggtgctcctatgtggcggtcggc
cactccgagcggcgccagtaccacggcgagaccgacgagctgtgcaacgccaaggtcaag
gccgccttcaagaacgacgtcacccccatcctgtgcgtcggcgagggcctggacgtgcgc
aaggcgggcaaccaggtcgcccacacgctcgcgcagatcgacgggggcctgaaggacatc
ccggccgagcaggccgagcggatcgtgatcgcgtacgagccggtctgggccatcggcacc
ggtgaggtggccacccccgaggacgcccaggaggtctgcggggccatccggggccgcctg
gccgagctgtacagccaggacgtggccgacaaggtccggatccagtacggcggctcggtg
aagtccggaaacgtcgccgcgatcatggcgcagccggacgtggacggcgcgctgatcggc
ggcgcggcgctggacgcggacgagttcgtcaagatcgtccggttccgcgaccagtga

DBGET integrated database retrieval system