KEGG   Streptomyces bingchenggensis: SBI_08113Help
Entry
SBI_08113         CDS       T01678                                 

Definition
putative bifunctional pectate lyase/pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sbh00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sbh00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9597952..9599865
Genome map
AA seq 637 aa AA seqDB search
MPAFQAPTAQARDKTQATTKTWPDKPDGFAATAGGTTGGAGGKVVTVRTQQDLTTYASAP
DPYIIRIAGSIDVSPFGSDIIVASNKTLIGVGTTGEIVHGELHLNPGTHNVIIRNLTIRD
SYVEGDWDGKTQDFDAIQMDTVHHVWIDHNTLTHMGDGLLDIRKDSDYITVSWNVFKNHN
KAFGLGWTDNVTTNITLHHNWFTGIKQRSPSIDNAAHAHLYNNYLSAQYRDEDPVWTYGN
WSRGRTKMVIENSYYDGIRNPYQADETAELVQRGSIARDTTGRHDTRGEAFDPRDFYPYR
LDPAAAVPALVKKFSGPQNSLGADTVLRVAADGSGDFRTVQGAVNAVPSGNDGRITIAIA
PGTYREQVRVPADKPHLTFLGTGRDRDDTVIVYDTPAEYGGSTGSATVLIAASDVTARHL
TFVNDFDEAAHDLKGEQALAMKTTGDRIVFTDTAFKGNQDTLMTDSPKLTTVSRVYLRDA
YIEGDVDFIYGRATTVIERSTIKALSRGSDSNNGYITAASTWKGNPYGFLITRSRIVSDA
PDQTFHLGRPWHPGGEPDAIAQVLIRDTWLPAAVKSSPWTDMGGFPWQEARFSEYRNTGP
GAAPSADRPRMTDADAADHEVADYLAGSDGWAPQTHR
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
gtgccagcgttccaggcccccacagcgcaagcacgagacaaaacgcaagccacaaccaaa
acctggcccgacaaacccgacggcttcgccgccaccgcaggcggcacaacaggcggcgcc
ggcggcaaagtagtaaccgtccgcacccagcaagacctcaccacgtacgcctccgccccc
gacccctacatcatccgcatcgcaggctccatcgacgtatcccccttcggctccgacatc
atcgtcgcctccaacaagaccctcatcggcgtcggcaccaccggggagatcgtccacggc
gagctccacctcaaccccggcacccacaacgtcatcatccggaacctcaccatccgggac
agctatgtcgagggcgactgggacggcaagacccaggacttcgacgcgatccagatggac
accgtccaccacgtgtggatcgaccacaacacgctcacccacatgggcgatggactgctc
gacatccgcaaggacagcgactacatcacggtctcctggaacgtcttcaagaaccacaac
aaggcgttcggcctcggctggaccgacaacgtgaccacgaacatcaccctgcatcacaac
tggttcaccggcatcaagcagcgcagcccgtccatcgacaacgccgcccacgcgcacctc
tacaacaactacctgtccgcccagtaccgggacgaggacccggtgtggacgtacggcaac
tggtcccgcggccggaccaagatggtgatcgagaacagctactacgacgggatccgaaac
ccctaccaggccgacgagacggccgaactggtccagcgcggcagcatcgcccgcgacacc
acgggccgccacgacacccggggcgaggccttcgacccgcgcgacttctacccgtaccgg
ctcgatccggccgccgccgtgcccgccctggtgaagaagttctccggaccgcagaacagc
ctcggcgccgacaccgtgctgcgcgtcgcggccgacggctcgggtgacttccgtaccgtc
cagggcgccgtcaacgctgtaccgtcgggcaacgacggacggatcacgatcgccatcgcg
cccggcacctaccgtgagcaggtccgcgtcccggccgacaagccgcacctcaccttcctg
ggcaccgggcgggaccgcgacgacaccgtgatcgtctacgacacccccgccgagtacggc
ggctccacaggcagcgccaccgtgctgatcgccgcgagcgatgtgaccgcccgccacctc
accttcgtcaacgacttcgacgaggccgcccacgacctcaagggcgagcaggcgctggcc
atgaagacgaccggcgaccggatcgtcttcacggacacggccttcaagggcaaccaggac
accctgatgaccgacagccccaagctgaccaccgtcagccgcgtctatctccgcgacgcg
tatatcgagggggacgtcgacttcatctacggccgcgccaccaccgtcatcgagcgctcc
accatcaaggcgctcagccgcggcagcgacagcaacaacggctacatcactgccgcgagc
acctggaagggcaatccgtacggctttctcatcacccggagccggatcgtcagcgacgcg
cccgaccagaccttccacctcggccgcccctggcatcccggcggcgagccggacgccatc
gcccaggtgctgatccgcgacacctggctgcccgccgcggtcaagtcgtctccgtggacg
gacatgggcggattcccatggcaggaagcccgtttcagcgagtaccgcaacaccggaccg
ggggccgccccgtccgccgaccgaccgcggatgacggacgccgacgccgcggaccacgag
gtggccgactacctcgcgggcagcgacggctgggcaccccagactcaccgctag

DBGET integrated database retrieval system