KEGG   Streptomyces bingchenggensis: SBI_08113Help
Entry
SBI_08113         CDS       T01678                                 

Definition
(GenBank) putative bifunctional pectate lyase/pectinesterase
  KO
K01051  pectinesterase [EC:3.1.1.11]
K01728  pectate lyase [EC:4.2.2.2]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00040  Pentose and glucuronate interconversions
sbh01100  Metabolic pathways
sbh02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SBI_08113
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SBI_08113
Enzymes [BR:sbh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     SBI_08113
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.2  pectate lyase
     SBI_08113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pectinesterase Pec_lyase_C Beta_helix Pectate_lyase_3
Motif
Other DBs
NCBI-ProteinID: ADI11231
UniProt: D7CI53
Position
9597952..9599865
Genome map
AA seq 637 aa AA seqDB search
MPAFQAPTAQARDKTQATTKTWPDKPDGFAATAGGTTGGAGGKVVTVRTQQDLTTYASAP
DPYIIRIAGSIDVSPFGSDIIVASNKTLIGVGTTGEIVHGELHLNPGTHNVIIRNLTIRD
SYVEGDWDGKTQDFDAIQMDTVHHVWIDHNTLTHMGDGLLDIRKDSDYITVSWNVFKNHN
KAFGLGWTDNVTTNITLHHNWFTGIKQRSPSIDNAAHAHLYNNYLSAQYRDEDPVWTYGN
WSRGRTKMVIENSYYDGIRNPYQADETAELVQRGSIARDTTGRHDTRGEAFDPRDFYPYR
LDPAAAVPALVKKFSGPQNSLGADTVLRVAADGSGDFRTVQGAVNAVPSGNDGRITIAIA
PGTYREQVRVPADKPHLTFLGTGRDRDDTVIVYDTPAEYGGSTGSATVLIAASDVTARHL
TFVNDFDEAAHDLKGEQALAMKTTGDRIVFTDTAFKGNQDTLMTDSPKLTTVSRVYLRDA
YIEGDVDFIYGRATTVIERSTIKALSRGSDSNNGYITAASTWKGNPYGFLITRSRIVSDA
PDQTFHLGRPWHPGGEPDAIAQVLIRDTWLPAAVKSSPWTDMGGFPWQEARFSEYRNTGP
GAAPSADRPRMTDADAADHEVADYLAGSDGWAPQTHR
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
gtgccagcgttccaggcccccacagcgcaagcacgagacaaaacgcaagccacaaccaaa
acctggcccgacaaacccgacggcttcgccgccaccgcaggcggcacaacaggcggcgcc
ggcggcaaagtagtaaccgtccgcacccagcaagacctcaccacgtacgcctccgccccc
gacccctacatcatccgcatcgcaggctccatcgacgtatcccccttcggctccgacatc
atcgtcgcctccaacaagaccctcatcggcgtcggcaccaccggggagatcgtccacggc
gagctccacctcaaccccggcacccacaacgtcatcatccggaacctcaccatccgggac
agctatgtcgagggcgactgggacggcaagacccaggacttcgacgcgatccagatggac
accgtccaccacgtgtggatcgaccacaacacgctcacccacatgggcgatggactgctc
gacatccgcaaggacagcgactacatcacggtctcctggaacgtcttcaagaaccacaac
aaggcgttcggcctcggctggaccgacaacgtgaccacgaacatcaccctgcatcacaac
tggttcaccggcatcaagcagcgcagcccgtccatcgacaacgccgcccacgcgcacctc
tacaacaactacctgtccgcccagtaccgggacgaggacccggtgtggacgtacggcaac
tggtcccgcggccggaccaagatggtgatcgagaacagctactacgacgggatccgaaac
ccctaccaggccgacgagacggccgaactggtccagcgcggcagcatcgcccgcgacacc
acgggccgccacgacacccggggcgaggccttcgacccgcgcgacttctacccgtaccgg
ctcgatccggccgccgccgtgcccgccctggtgaagaagttctccggaccgcagaacagc
ctcggcgccgacaccgtgctgcgcgtcgcggccgacggctcgggtgacttccgtaccgtc
cagggcgccgtcaacgctgtaccgtcgggcaacgacggacggatcacgatcgccatcgcg
cccggcacctaccgtgagcaggtccgcgtcccggccgacaagccgcacctcaccttcctg
ggcaccgggcgggaccgcgacgacaccgtgatcgtctacgacacccccgccgagtacggc
ggctccacaggcagcgccaccgtgctgatcgccgcgagcgatgtgaccgcccgccacctc
accttcgtcaacgacttcgacgaggccgcccacgacctcaagggcgagcaggcgctggcc
atgaagacgaccggcgaccggatcgtcttcacggacacggccttcaagggcaaccaggac
accctgatgaccgacagccccaagctgaccaccgtcagccgcgtctatctccgcgacgcg
tatatcgagggggacgtcgacttcatctacggccgcgccaccaccgtcatcgagcgctcc
accatcaaggcgctcagccgcggcagcgacagcaacaacggctacatcactgccgcgagc
acctggaagggcaatccgtacggctttctcatcacccggagccggatcgtcagcgacgcg
cccgaccagaccttccacctcggccgcccctggcatcccggcggcgagccggacgccatc
gcccaggtgctgatccgcgacacctggctgcccgccgcggtcaagtcgtctccgtggacg
gacatgggcggattcccatggcaggaagcccgtttcagcgagtaccgcaacaccggaccg
ggggccgccccgtccgccgaccgaccgcggatgacggacgccgacgccgcggaccacgag
gtggccgactacctcgcgggcagcgacggctgggcaccccagactcaccgctag

DBGET integrated database retrieval system