KEGG   Streptomyces bingchenggensis: SBI_08143Help
Entry
SBI_08143         CDS       T01678                                 

Gene name
chlI
Definition
chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SBI_08143 (chlI)
Enzymes [BR:sbh01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     SBI_08143 (chlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9629657..9631849)
Genome map
AA seq 730 aa AA seqDB search
MTATPYPFTALVGMADLRLALLLNAVSPAVGGVLVRGEKGTAKSTAVRALAALLPGIDVV
ADCRFSCDPAAPDPGCPDGPHEPGSGTVRPARMVELPVGASEDRLVGALDIERALSDGVK
AFEPGLLADAHRGVLYVDEVNLLHDHLIDLLLDAAAMGASYVEREGVSVRHAARFLLVGT
MNPEEGELRPQLLDRFGLTVEVAASRDTDERVEVVRRRLAYDEDPAGFAARWADEEGTLR
ERVAAARALLRQVRLSDGALRQIAAVCAAFEVDGMRADIVTARTATALAAWAGRTEVTTE
DVRQAALLSLPHRRRRAPFDAPGLDEDKLDEVLRETGGGDDEPDPGPGPEGRDEQDGPGG
PDGPGGPGGPDGPGGGQPPQGAPEQSPPSAGSSVPEQRTGPDGSNGPEGSNSSDSQVSDA
TDEGVGGAAAGGPGGERAAVGAAEPFRTRRLDVPGLGEGAAGRRSRARTAHGRTTGARRP
RSTLSKLHLSATIRAAAPHQRSRGRQGPGLVVRRDDLREAVREGREGNLVLFVVDASGSM
AARKRMSAVKGAVLSLLLDAYQRRDKVGLITFRGAEAALALPPTSSVDAGAARLEKLPTG
GRTPLAAGLLKAHEVLRIERLRDPSRRPLLVVVTDGRATGGPDPVARAGRAARLLADDGV
ASVVVDCEAGPVRLGLAGALAHELRGTPVTLDELRADSMTALVRDARGTNTARTVRETRT
VSVRGTWRAA
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaccccctacccgttcaccgcgctcgtcggaatggccgacctgcggctggcg
ctcctgctcaacgccgtgtcaccggccgtcggcggagtgctggtgcgcggcgagaagggc
accgcgaagtcgacggcggtgcgggcgcttgccgccctgctgcccggcatcgacgtggtg
gccgactgccggttctcctgcgaccccgccgcgcccgacccgggctgcccggacggcccg
cacgagccgggcagcggcaccgtacgccccgcccggatggtcgagctgccggtcggcgcc
tccgaggaccggctggtcggggcgctggatatcgagcgggcgctgtccgacggggtgaag
gcgttcgagccgggtctgctggccgacgcgcaccgcggcgtgctgtacgtcgacgaggtc
aacctgctgcacgaccacctgatcgacctgctgctcgacgcggccgccatgggcgcctcc
tacgtggagcgcgagggcgtgtccgtacggcacgcggcgcgctttctgctggtgggcacc
atgaaccccgaagagggcgagctgcggccgcagttgctggaccgcttcggcctgacggtg
gaggtcgcggcgtcgcgggacaccgacgagcgggtcgaggtggtgcggcggcggctggcg
tacgacgaggacccggccgggttcgcggcgcgctgggcggacgaggagggcacgctgcgg
gagcgcgtggcggcggcccgcgccctgctgcggcaagtgcggctgagcgatggcgcgctg
cggcagatagcggcggtgtgcgcggcgttcgaggtggacgggatgcgcgcggacatcgtg
acggcgcgaacggcgacagcgctggcggcgtgggcggggcgtacggaggtgaccaccgag
gacgtacggcaggccgcgctgctgtcgctgccgcaccggcggcggcgagcgccgttcgac
gcgccggggctggacgaggacaagctcgacgaggtgctgcgcgagaccggcggcggggac
gacgaaccggacccggggccggggccggagggtcgggacgaacaggacggacctggcggg
ccggacggacctggcggtccagggggtccggacggcccgggcggcgggcagccgccgcag
ggcgcgccggagcagtcgccgccgtcggccggatcgtccgtaccggagcagcgcacgggc
cccgacggctccaacggccccgagggatccaacagctcggacagccaggtctctgatgcc
accgacgagggcgtgggcggggccgcggcgggcgggcccggcggcgaacgcgcggccgtg
ggcgccgccgagccgttccggacccggcggctcgacgtaccggggctcggcgagggcgcg
gcggggcggcggtcgcgcgcccgtacggcccacggccgtaccaccggcgcgcgccgcccc
cgctccaccctgtccaagctgcatctgtcggcgaccatacgggccgccgcaccgcaccag
cgctcgcgcggccgacagggccccgggctcgtggtgcgccgtgacgacttgcgtgaggcg
gtgcgcgagggccgcgagggcaacctcgtgctgttcgtggtggacgcgtcggggtcgatg
gccgcgcggaagcgtatgagcgccgtcaagggcgccgttctgtcgctgctgctggacgcc
taccagcgacgggacaaggtcggactgatcaccttccggggcgccgaggccgccctggcg
ctgccgcccacctcgtcggtggacgcgggcgccgcccggctggagaagctgcccaccggc
gggcgcaccccgctggccgccgggctgctgaaggcacacgaggtgctgcggatcgagcgg
ctgcgggatccgtcgcgccgtccgctgctggtcgtggtgacggacgggcgcgccacgggc
ggcccggacccggtggcccgggccgggcgcgcggcccggctgctggccgacgacggggtc
gcctcggtggtggtggactgcgaggcggggcccgtccggctgggcctggcgggcgcgctg
gcgcacgaactgcgcgggacgccggtgacgctcgacgaactgcgcgcggacagcatgacc
gcgctggtgcgcgacgcgcgcgggacaaacaccgcacggaccgtacgagagacacggacc
gtttccgtacgagggacctggagggccgcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system