KEGG   Streptomyces bingchenggensis: SBI_08149Help
Entry
SBI_08149         CDS       T01678                                 

Gene name
fucA
Definition
fuculose-1-phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sbh00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9637106..9637792
Genome map
AA seq 228 aa AA seqDB search
MTKPETARPNGLGERPDLREGWERVVETARRTVADGLVVGTSGNVSARVGDIVLVTPSGV
PYDRLGPGDAVGVDLDGRQVIGELAPTSELPMHLAIYRDTDAAAVVHTHAVHATAVSTLV
DEVPAIHYMTCALGGPVRVAGYALYGTDELAQNMLDALRDRTGCLLRNHGTVVHGATLDQ
AYDRTAQLEWMCRVWLTAAAVPGYTPALLSPEELRRAADKLSGYGQPR
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaagccggagaccgcacgaccgaacggacttggggagcgaccggacctgcgggag
ggctgggaacgggtggtggagacggcccgcaggacggtcgccgacggcctggtcgtcggc
acctcgggcaatgtctcggccagggtcggcgatatcgtcctggtgaccccgagcggcgtc
ccgtacgaccggctcggcccgggtgacgcggtcggcgtcgacctggacgggcgtcaggtg
atcggcgaactggcccccaccagcgaactgccgatgcacctcgccatctaccgcgacacc
gacgccgcggccgtcgtccacacccacgccgtacacgccacggccgtctccacactggtc
gacgaggtccccgcgatccactacatgacctgcgccctcggcggcccggtgcgcgtcgcg
ggctacgccctgtacggcaccgacgagttggcccagaacatgctcgacgcactgcgcgac
cgcaccggctgtctgctgcgcaaccacggcactgtcgtccacggcgccacgctcgaccag
gcgtacgaccggacggcccagctggagtggatgtgccgggtctggctcaccgcggccgcc
gtccccgggtacaccccggccctgctgtcacccgaagagctgcgccgcgccgcggacaag
ctcagcggctacggccagcctcgctga

DBGET integrated database retrieval system