KEGG   Streptomyces bingchenggensis: SBI_08394Help
Entry
SBI_08394         CDS       T01678                                 

Gene name
nanG8
Definition
putative secreted endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SBI_08394 (nanG8)
Enzymes [BR:sbh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SBI_08394 (nanG8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9910426..9911487
Genome map
AA seq 353 aa AA seqDB search
MAEKGLGRVTARQWAPLVGCAAALLALSGCLGTSGGSDRQSGLWVDPDNPAARKAREQRR
AGRYAEAELMRRIADEPIAEWLGPHPRERVRFITESAAREHRTPVLVAYHIPYRDCGRYS
RGGAGSDAEYLDWIREIVSGIGERRAIVVLEPDAIAQVVDGCIPKPLRAPRLALLRDAVA
MLSAMPATRIYLDAGNPGWIKDTERLVEPLMKSGIDQADGFALNVSNFQPTAVTRAYGRR
LSLQLGRVHFIIDTSRNGNGPLTSVRGEGDDGKSGDMGAVRSASDGQESWCNPPGRALGD
PPSTRTGDPAIDAYLWIKRPGESDGPCNGGPPAGRWWTEYALDLARNANLRER
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaaagggctcgggagagtcaccgcgcgacagtgggcgccgcttgtgggatgt
gccgccgcgctcctcgcgctgagcggatgtctcggcacgtcaggcgggtcggaccggcag
agcgggctatgggttgacccggacaacccggccgcccggaaggcccgtgagcagcggcgc
gcgggccgttacgcggaggcggagctcatgcggcggatcgccgacgagccgatcgccgaa
tggctcggcccgcatccgcgcgaacgggtccggtttatcaccgaatccgcggcgcgggag
caccgtacgccggtgctggtcgcctatcacattccgtaccgggactgcggaagatactcc
cggggcggggcgggaagcgacgccgaatatctggactggatccgtgagatcgtctccgga
atcggtgagagaagggcgattgtcgtattggaacccgacgcgattgctcaggtggtcgac
ggctgcattcccaagccgctgcgtgcaccgcggctggccctgctgcgcgacgcggtcgcc
atgctctccgcgatgcccgccacccggatctatctggacgccgggaacccggggtggatc
aaggacaccgagcggctggtggagccgctgatgaaaagcggcatcgaccaggcggacggc
ttcgccctgaacgtctcgaacttccagccgacggcggtgacccgcgcttacggccgtcgg
ctgtccctccagctcggcagggtccacttcatcatcgacaccagccgcaacggcaacggc
ccgctcacctccgtcaggggcgagggcgacgacggcaagagcggtgacatgggcgccgtg
cgctccgccagcgacggccaggagagctggtgcaaccccccggggcgggctctgggggat
cccccgagcacccgtacgggcgaccccgccatcgacgcgtatctgtggatcaagcgtccg
ggagagtccgacgggccctgcaacggcggcccgcctgcgggtcgttggtggacggagtac
gcgctcgacctggcccgtaacgccaacctgcgcgaaaggtga

DBGET integrated database retrieval system