KEGG   Streptomyces bingchenggensis: SBI_08831Help
Entry
SBI_08831         CDS       T01678                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sbh00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sbh00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sbh02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(10469040..10470629)
Genome map
AA seq 529 aa AA seqDB search
MARESDRGVGRRQVLRGSAAASAGLALPALASSPAWASAAPAQALSGRPSAQWGVQVGDV
TTSSGLVWVRSDRPARMVVETSATESFAKARRWRGPVLGAGSDFTGTTALHGLPPGAQVH
YRVLLADPDDPRRTGEPVYGTFRTAPARRQGLRFVWSGDLAGQGWGINPDLGGYRIFEEM
RRLDPDFFLCSGDNIYADGPMTQSVTLPDGRTWRNITTEEKSKVAETLAEYRGNFRYNLL
DANLRRFNAQVPTIVQWDDHEVLNNWYPGEILTDDRYTEKNVNVLAARSRQAFSEYFPIS
TMRQDREGRVYRVLRHGPLLDVFVLDCRTYRDANSPGRQPEDTQGILGAEQLAWLKRELS
ASRAVWKVIACDMPLGLVVPDGATDFEAVSQGDPGAPLGRELQIAELLRHIKHRKITGTV
WLTADVHYTSAQHYDPSRAAFKDFAPFWEFVSGPLNAGSFPAVKLDGTFGPEQPFVKAPT
RANVSPAEGFQFFGEVDIDGHSGELTVRLRELGGTVLFTKVLQPGRVGQ
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggaatccgatagaggggttggacggcggcaggtactgcgggggtcggcggcg
gcgtccgccgggctggcgctcccggcgctggcgtcttcgccggcctgggcgtcggccgcg
cccgcgcaggcgctgtccgggcggccgagcgcccagtggggcgtccaggtgggcgacgtc
acgacgtcctcgggcctggtgtgggtccgctcggaccgtccggcccggatggtcgtcgag
acgtccgcgaccgagtcgttcgcgaaggcgcggcgctggcggggcccggtgctgggcgcc
ggcagcgacttcaccggcaccaccgcgctgcacgggctgccgccgggcgcccaggtgcac
taccgggtgctgctcgccgacccggacgacccgcgccgcaccggcgagccggtgtacggg
acgttccgtaccgcgccggcccgccgccaggggctgcggttcgtgtggtcgggcgacctg
gcgggacagggctggggcatcaacccggacctcggcggctaccggatcttcgaggagatg
cgccggctggacccggacttcttcctgtgcagcggggacaacatctacgccgacggcccg
atgacgcagagcgtgacgctgcccgacggccgcacctggcggaacatcaccacggaggag
aagtccaaggtcgccgagacgctggcggagtaccggggcaacttccggtacaacctcctc
gacgccaatctccgccgcttcaacgcccaggtgcccaccatcgtccagtgggacgaccac
gaggtgctgaacaactggtacccgggcgagatcctcaccgacgaccgctacaccgagaag
aacgtgaacgtgctggcggcgcgctcgcggcaggccttcagcgagtacttccccatctcc
acgatgcggcaggaccgcgagggccgggtgtaccgggtgctgcggcacggcccgctgctc
gatgtgttcgtgctggactgccgtacgtaccgcgacgccaactcccccggccggcagccg
gaggacacccagggaatcctcggcgccgagcagctggcctggctcaagcgggagctgtcg
gcgtcgcgcgcggtgtggaaggtgatcgcgtgtgacatgccgctgggtcttgtggtcccg
gacggggcgacggacttcgaggcggtctcgcagggcgacccgggcgcgccgctgggccgt
gagctgcagatcgcggagctgctgcggcacatcaagcaccggaagatcaccggcacggtg
tggctgacggcggacgtccactacaccagcgcccagcactacgacccgtcgcgggcggcc
ttcaaggacttcgccccgttctgggagttcgtctccgggccgctgaacgcgggctcgttc
ccggcggtgaagctggacggcaccttcgggccggagcagcccttcgtcaaggcgccgacc
agggcgaacgtctctccggccgagggcttccagttcttcggcgaggtggacatcgacggg
cacagcggcgagctgacggtccggctgcgcgaactgggcggcacggtgctgttcaccaag
gtgctgcagcccgggcgcgtcggccagtga

DBGET integrated database retrieval system