KEGG   Streptomyces bingchenggensis: SBI_09085Help
Entry
SBI_09085         CDS       T01678                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SBI_09085
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SBI_09085
   00650 Butanoate metabolism
    SBI_09085
  Amino acid metabolism
   00360 Phenylalanine metabolism
    SBI_09085
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SBI_09085
   00622 Xylene degradation
    SBI_09085
   00621 Dioxin degradation
    SBI_09085
Enzymes [BR:sbh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SBI_09085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10776515..10777441
Genome map
AA seq 308 aa AA seqDB search
MTVAERVTAGPATVPPITVAIIGTGVIGRDLVGKVHRSTVLNCGLVAGRNPESEGLRYAA
GLGCPTTAEGIDAILAAPRPYDVVFDATNAMSHAEHWRLLQPLDTLLIDLTPSRVGRMVV
PTVTGTRPPAERNVSLISCGGQASIPIAHALAQRFEVAYIEAVSTVAGTIAGRATRLNLD
EYIATTQHALTALAGVRDTKAILNISPAVPPATFRTAVHAVVPGADPEAVRALVDDAAER
VRAHQPGYEVIACTVTGDRVVVALEVTADSDVLPRYAGNLDIINSAAILVAEQHAARLAP
AARTGVGR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcgctgagcgcgtcaccgccgggcccgccaccgtcccgcccatcaccgtcgcc
atcatcggcaccggggtcatcggccgggacctggtcggcaaggtccaccgctccaccgtg
ctcaactgcggcctggtggccgggcgcaaccccgagtccgaggggttacggtacgccgcc
gggctcggctgcccgaccactgcggagggcatcgacgcgatccttgcggccccgcgcccg
tacgacgtggtgttcgacgccaccaacgcgatgtcgcacgccgaacactggcggctgctc
cagccgctggacacgctgctgatcgacctgacccccagccgggtaggccggatggtggtg
cccacggtgaccgggacccgcccgcctgccgagcgcaacgtcagcctcatcagctgtggc
ggacaggcgtcgatcccgatcgcccacgccctcgcccagcggttcgaggtggcgtacatc
gaagccgtctccaccgtggccggcaccatcgcgggccgggccacccggctcaacctcgac
gagtacatcgccaccacccagcacgccctcaccgcgctcgcaggggtgcgcgacaccaag
gcgatcctcaacatcagtccggccgtgcccccggcgaccttccggaccgccgtccacgcg
gtcgtccccggggcggaccccgaggcggtgcgcgccctggtcgacgacgcggccgagcgg
gtacgggcgcatcagcccgggtacgaggtcatcgcctgcacggtgaccggcgaccgggtc
gtggtcgccctggaggtcaccgcggacagcgacgtactgccccggtacgccggaaacctg
gacatcatcaactcggccgccatcctggtcgccgagcagcacgcggcccggctcgccccg
gccgcccggacgggggtgggccgatga

DBGET integrated database retrieval system