KEGG   Streptomyces bingchenggensis: SBI_09108Help
Entry
SBI_09108         CDS       T01678                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SBI_09108 (glpK)
Enzymes [BR:sbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SBI_09108 (glpK)
Exosome [BR:sbh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SBI_09108 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10801322..10802839
Genome map
AA seq 505 aa AA seqDB search
MPEFVGAVDQGTTSTRFMIFDHDGAEVAKYQLEHRQILPRSGWVEHDPVEIWERTNSVMQ
NAIRASELAPADLAAIGITNQRETTVVWDPRNGMPYYNAIVWQDTRTDSIAAALERDGRG
EVIRRKAGLPPATYFSGAKIQWILENVDGVREAAERGHALFGNTDSWVLWNLTGGPGGGV
HATDVTNASRTMLMNLETLDWDDELLEIFGVPRTMLPTINPSAHPEAFGHTRTTRPLSRA
IPVTGVLGDQQAATVGQVCFSPGEAKNTYGTGNFLLLNTGTELVRSHNGLLTTVAYRFGD
GPTVYALEGSIAVTGSAVQWLRDQLKVIDDAAASERLARTVEDSGGIYFVPAFSGLFAPY
WRSDARGAIVGLSRYHSGGHLARATLEAICYQSRDVVEAMDQDSGVHLDVLKVDGGVTAN
DLCMQIQADVLGVPVSRPRIAETTALGAAYAAGLATGFWRDTDELRSHWQESRRWEPQWS
RERREEGYAGWKRAVERTLDWVKVQ
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgccggaattcgtcggtgcggtggaccagggaaccaccagcacccgttttatgatcttc
gaccacgacggcgcggaagtggcgaaataccagctggaacaccgccagatcctgccgcgc
tccggatgggtcgaacacgacccggtggagatctgggagcgcaccaactcggtcatgcag
aacgcgatccgggccagcgaactggcgcccgccgaccttgccgcgatcggcatcaccaat
cagcgggagaccaccgtcgtctgggatccgcgcaacgggatgccgtactacaacgccatc
gtctggcaggacacccgcaccgacagcatcgccgccgccctggaacgcgacggccgtggc
gaggtcatccgccgtaaggccggtctgccgccggccacctacttctccggtgcgaagatc
cagtggatcctggagaacgtcgacggcgtccgcgaggccgccgagcgcggccacgccctc
ttcgggaacaccgacagctgggtgctgtggaatctcaccggcggccccggcggcggtgtc
cacgccaccgatgtgaccaacgccagccgcaccatgctgatgaacctggagaccctggac
tgggacgacgagctgctggagatcttcggtgtgccgcggacgatgctgccgacgatcaac
ccctcggcccaccccgaggcgttcggccacacccgcaccacccgcccgctgagcagggcc
atccccgtcaccggtgtgctcggcgatcagcaggcggccaccgtgggccaggtctgcttc
tcgcccggcgaggcgaagaacacctacggcaccggtaacttcctgctgctcaacacgggt
accgaactcgtccgttcccacaacgggctgctcaccaccgtggcgtaccggttcggtgac
ggccccaccgtctacgccctggagggctccatcgcggtgaccggctcggccgtgcagtgg
ctgcgcgaccagctgaaggtcatcgacgacgcggccgcgagcgagcggctggcccgcacg
gtcgaggacagcggcgggatctacttcgtcccggccttctccgggctgttcgccccgtac
tggcgctccgacgcgcgcggcgcgatcgtcggcctgtcccgctaccacagcggcggccat
ctggcgcgggccacgctggaggccatctgctaccagagccgggacgtggtggaggccatg
gaccaggattccggtgtccacctcgacgtgctcaaggtggacggcggggtcaccgcgaac
gacctgtgcatgcagatccaggccgatgtcctcggcgtcccggtcagccgcccccgaatc
gccgagaccaccgcgctgggcgccgcctacgccgcgggcctggccaccgggttctggcgc
gacaccgacgagctgcgctcgcattggcaggagtccaggcggtgggagccccagtggagc
cgggagcggcgggaagagggctacgcgggctggaaacgggccgtcgaacgcacgcttgac
tgggtgaaggttcaataa

DBGET integrated database retrieval system