KEGG   Streptomyces bingchenggensis: SBI_09115Help
Entry
SBI_09115         CDS       T01678                                 

Definition
twin-arginine translocation pathway signal
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sbh00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sbh00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sbh02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10812930..10814504
Genome map
AA seq 524 aa AA seqDB search
MPGQATEAQPSDRRPSDRRRFLAAGAAAVGAATVGQLALTGTARAADPALPSGVFTLGVA
SGDPLPDGVVLWTRLAPDPLNGGGMPDRAVDVAWQVAEDPRFRRIVRQGTAQALPALGHS
VHVDVRGLRPHREYWYRFRAADQISPAGRTRTAPSPHAATPLRLALASCQNWQHGYFTPY
ADMAEQDPDAVLFIGDYIYESTPAATGARRHEGSGEPYSLVQYRNRYAQYHTDPDLARMH
AQAPWIVTFDDHEVDNDWAGEIPQDPDKQPHDAFVARLTAAYQAYYEHMPVRATAVPNGP
HIKMYRSLDFGSLARLQVLDTRQYRSDQVTTQEAAQNPLLTMLGAEQKQWLLDGLRRSPA
RWNLIGSQIMMAETDRLAGPGKLWFYDAWDGYQAERNELMAEFAQVRNPVVLSGDRHLTM
ISDLKRDFADPASPVVGAEFVGTSISSNGDQDQAAFHAEFDPLVPDNPHWKLLDAHRGYH
LFDIDRGGIDAQVRIVDTVVQPQSAARTLARLRVENGRPGVDLV
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgcctggacaggccaccgaagcacagccatccgacagacgcccatccgacagacgtaga
ttcctcgccgccggcgccgcggccgtcggcgcggcaaccgtgggccagttggccctcacg
ggcaccgcacgcgccgcggatcccgcgctccccagcggcgttttcaccctgggcgtggcc
tcgggtgacccgctgcccgacggggtggtgctgtggacccgcctcgcccccgatccgctg
aacggcggcggtatgcccgaccgggccgtcgacgtcgcctggcaggtggccgaggacccg
cgcttccggcgcatcgtcaggcaggggaccgcacaggccctgcccgccctcggccacagc
gtccacgtggacgtacgcggtctgcggccgcaccgcgagtactggtaccggttccgcgcc
gccgaccagatatccccggccggccgcacccgcaccgccccctcgccgcacgccgcaacc
ccgctgcggcttgccctcgcctcctgccagaactggcagcacggctacttcacgccgtac
gccgacatggccgaacaggacccggacgccgtgctgttcatcggcgactacatctacgag
agcacgcccgccgccaccggcgcacgccgccacgagggcagcggcgagccgtactcactc
gtccagtaccgcaaccggtacgcgcagtaccacaccgaccccgacctcgcccggatgcac
gcccaggcgccctggatcgtcaccttcgacgaccacgaggtggacaacgactgggcgggc
gagatcccccaggacccggacaagcagccgcacgacgcgttcgtcgcccggctgaccgcc
gcctaccaggcgtactacgagcacatgccggtgcgcgccaccgcggtgccgaacggcccg
cacatcaagatgtaccgcagcctggacttcggcagcctggcccggcttcaggtgctggac
acccggcagtaccgcagcgaccaggtcaccacgcaggaggccgcgcagaacccgctgctg
acgatgctcggggccgagcagaagcagtggctgctggacgggctgcgccgctcgcccgcc
cgctggaacctgatcggctcacagatcatgatggccgagaccgaccggctcgcgggcccc
ggcaagctctggttctacgacgcctgggacggctaccaggcggaacgcaatgagctgatg
gccgagttcgcccaggtccgcaacccggtggtgctctccggggaccgccatctgacgatg
atcagcgacctcaagcgggacttcgccgaccccgcctcgccagtggtgggggccgagttc
gtgggcacgtccatctcctcgaacggggaccaggaccaggccgccttccacgccgagttc
gacccactggtgcccgacaacccgcactggaagctcctcgacgcccaccggggataccac
ctcttcgacatcgaccgcggcggtatcgacgcccaggtccggatcgtggacaccgtggtc
cagccccagtcggcggcgcggaccctggcgcggctgcgggtggagaacggacggcccggg
gtcgacctggtgtga

DBGET integrated database retrieval system