KEGG   Streptomyces bingchenggensis: SBI_09547Help
Entry
SBI_09547         CDS       T01678                                 

Definition
(GenBank) asparagine synthetase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00250  Alanine, aspartate and glutamate metabolism
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SBI_09547
Enzymes [BR:sbh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     SBI_09547
Peptidases [BR:sbh01002]
 Cysteine Peptidases
  Family C44
   SBI_09547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 tRNA_Me_trans DUF1933 DUF3700 NAD_synthase QueC
Motif
Other DBs
NCBI-ProteinID: ADI12665
UniProt: D7C9F3
Position
11357268..11359202
Genome map
AA seq 644 aa AA seqDB search
MCGIAGTYRWPDGKVVTDRLTDTLAHRGPDGAGRYSHPVGDGEVHLGHRRLAIIDLSETG
AQPMVSGGLVLTYNGELYNAPELRAELAAAGVRFRGTSDTEVLLEAWRRWGTDCLPRLRG
MFAFGIFDERTGDLVLARDQLGIKPLFLLRRGEGLVFASELKALAAVTGGSLQVDHAALV
ASLLYYWVPDSRCAFREAEKLPPGSWLRCRPDGRVERGRFWHLKDVAAEGRERARSGEQP
DLAAIVEESTRRHLLSDVPVATFLSGGLDSSYLTALAARHQPGISAYTIGFRAEDARFEA
MPDDLRYARRVAERFGVDLHEIEIAPNVLDLLPQMTYHLDEPIGDPAAINTFLICSAARE
AGVKVMLSGMGADELFAGYRKHLANLLALRYQRVPRPLRRGLSRAVDRLPVATARRGYRS
VRFAKRFLSFADLPEETAFRRSYTMYDQDELLALVDPDLAGTVEDVLTEHADVYQDNDLD
DFVNRMCLGDSRMFLPGLNLTYTDRSSMAASTEVRVPYVDVEVVKAAFAVPGDRKIVGRQ
GKAVLKEAATSILPREIVYRPKGLFSAPLRAWMSRDLAPLVREVVNDGVLVRSGFLRRDA
LARMVAEDASGQRDFSKHLWHVLTLEYWYRDATSGSGQSARLTA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatcgcaggcacttaccgatggccggacgggaaggtcgtgaccgaccggctc
accgataccctcgcccatcgcggtccggacggggcgggccggtacagccaccccgtcggt
gacggcgaagtgcacctcgggcaccgtcggctggccatcatcgacctgtccgagaccggc
gcccagccgatggtctcgggcggcctcgtcctgacgtacaacggcgagctgtacaacgcg
cccgagctgcgtgccgagctggcagccgccggggtgcgcttccgcggtacctccgacacc
gaggtgctgctggaggcctggcggcgctggggcacggactgcctgccccggctgcgcggc
atgttcgcgttcgggatcttcgacgagcgaaccggtgacctggtgctcgcccgcgaccag
ctcggcatcaagccgctgttcctgctccggcggggcgagggtctggtgttcgcctccgag
ctcaaggcgctcgccgccgtgaccggcgggtcgctgcaggtggaccatgcggcgctggtg
gcctcgctgctgtactactgggtgccggactcacggtgcgcgttccgcgaagcggagaag
ctgccgccggggagctggctccggtgccggcctgacggccgggtggagcgcggccggttc
tggcacctgaaggacgtcgccgccgagggccgggagcgggcccggagcggcgagcagccg
gacctggccgccatcgtcgaggagtcgactcggcgccacctgctctccgacgtacccgtg
gcgaccttcctctccggcggtcttgactccagctacctgaccgcgctggcggcccgccac
caacccgggatctccgcttacacgatcgggttccgcgccgaggacgccaggttcgaggcg
atgccggacgacctgcgctatgcccggcgggtggccgagcggttcggcgtcgacctgcat
gagatcgagatcgctcctaacgtgctcgacctgctgccgcagatgacgtaccacctggac
gagccgatcggcgaccccgccgcgatcaacactttcctgatctgctcggccgcccgggag
gccggggtcaaggtgatgctctcggggatgggtgccgacgagctgttcgccggttaccgc
aagcacctggccaacctgctcgcgctgcgctaccagcgcgtcccgcggcccctgcggcgc
ggcctgtccagggccgtggaccggctgcctgtcgccacggcccgccgggggtaccggtcg
gtgcgcttcgcgaagcggttcctctccttcgccgatctgccggaggagaccgcgttccgg
cgcagctacaccatgtacgaccaggacgaactgctcgccctggtcgatccggacctggcc
gggacggtcgaggacgtgctcaccgagcatgcggacgtctaccaggacaacgacctcgac
gacttcgtcaaccgcatgtgcctgggggactcccggatgttcctgccgggcctgaacctc
acctacacggaccggtcgagcatggccgcgtcgaccgaggtgcgggtgccgtacgtggac
gtcgaggtggtcaaggctgcgttcgccgtgcccggtgatcgcaagatcgtcgggcggcag
ggcaaggccgtcctcaaggaggcggccacctcgatcctgccccgggagatcgtctaccgg
cccaagggcctgttcagcgccccgctgcgcgcctggatgagccgggatctggcaccgctg
gtgcgcgaggtggtgaacgacggcgtgctcgttcgttccgggttcctgcgccgcgatgcg
ctggcgcggatggtcgccgaggacgcctccgggcagcgggacttctccaagcatctgtgg
catgtgctgaccctcgagtactggtatcgcgacgcgacctctgggtccggccagagcgct
cggttaacggcttag

DBGET integrated database retrieval system