KEGG   Streptomyces bingchenggensis: SBI_09850Help
Entry
SBI_09850         CDS       T01678                                 

Definition
alcohol dehydrogenase GroES-like protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SBI_09850
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBI_09850
  Lipid metabolism
   00071 Fatty acid degradation
    SBI_09850
  Amino acid metabolism
   00350 Tyrosine metabolism
    SBI_09850
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SBI_09850
   00626 Naphthalene degradation
    SBI_09850
Enzymes [BR:sbh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SBI_09850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11725327..11726373
Genome map
AA seq 348 aa AA seqDB search
MKMRALRLTAWGEPPAPAEVERPTPRGTEVLVQVEAAGLCRSDLHVIDGAPGSLPYRLPF
TLGHEVAGRAAALGPDADGVAVGERVVLYGPWGCGACDRCATGRDNYCDRRDTLTWHGAG
LGRDGGMAEYLLVPSARHLVPIGDLPADQAAPLSDAGLTSYHAVAGLRHALREGTSTVVI
GVGGLGHLAVQILRATTTSRVLAVDVREDALALADRSGADFGTLMRPDTARVLRARTGDA
GADAVLDFVGTAKTLELATGVLRPGGELAFVGSGGGCLTVSKPGVLPPGFRLSLPFWGTR
PELAEVVTLARSGALHVESERFPLSAAPEAIGRLRRGQVRGRTVLVPD
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatgagggcactgaggctgacggcgtggggcgagcccccggcaccggccgaagtc
gagcggcccacgccccgtggcaccgaggtactggtgcaggtggaagccgccgggctgtgc
cgttccgacctgcacgtcatcgacggggcccctgggtcgctcccctaccgtctgccgttc
accctcggccacgaggtcgccgggcgggccgcggccctgggtcccgacgccgacggggtg
gcggtcggtgaacgcgtggtgctctacggaccgtggggctgcggcgcctgcgaccgttgc
gccacgggccgggacaactactgcgaccggcgtgacaccctcacatggcatggggccgga
ctcggccgggacggcggaatggccgagtacctcctcgtcccgtccgcccgccatctggtg
ccgatcggcgacctgccggccgatcaggcggccccgctctccgacgcgggtctgacgtcc
taccacgccgtggccgggctccggcacgcactccgtgagggcacctccactgtcgtcatc
ggtgtcggcgggctcggtcacctggctgtccagatcctccgcgcgaccaccacgagccgc
gtactggcggtcgatgtccgggaggatgccctggctctcgcggaccgctccggcgcggac
ttcggcaccctgatgcggccggacaccgcccgcgtgctgagggcacggaccggtgacgcg
ggagccgacgccgtgctcgacttcgtcggcaccgcaaagaccctggaactcgcgaccggc
gtcctgcgccccggcggtgaactcgccttcgtcggaagcggaggcggctgcctgacggtc
tccaaaccgggcgttctcccacccggcttccggctctcgctgcccttctggggaacccgc
cccgagctcgccgaggtcgtcacgctggcacgctcgggagccctccacgtcgaatcggaa
cggttcccgctgtccgcggcaccggaagcgatcggccggcttcggcggggccaggtgcgg
ggccggaccgtgctcgtccccgactga

DBGET integrated database retrieval system