KEGG   Streptomyces bingchenggensis: SBI_09935Help
Entry
SBI_09935         CDS       T01678                                 

Definition
putative glycosyl hydrolase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
sbh  Streptomyces bingchenggensis
Brite
Enzymes [BR:sbh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     SBI_09935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11818375..11820477
Genome map
AA seq 700 aa AA seqDB search
MKPPGRYRTLALGLLAAGVMAVAGTAAPASATATATATATDSAAASDSVQASTLGAQAAQ
SGRYFGAAVAAGRLGDGTYSTILDREFNMVTPENEMKWDTTERSRGSFNFGPADQIVNRA
TSRGQRVRGHTLVWHSQLPSWVSSIGDANTLRSVMNNHINGVMGHYKGKVYAWDVVNEAF
ADGGSGAHRPSVFQNLLGDGFIEEAFRTARAADASAKLCYNDYNIENWTDAKTQGVYRMV
RDFKTRGVPIDCVGFQAHFGTGGPPASFQTTLSNFAALGVDVQITELDIAQAPTTAYANT
VKACMNVARCNGLTTWGIRDTDSWRAGEKPLLFDGNGNKKAAYNSALTAMGGTPAVKGTA
NTVTKTAAKDPTKTPASPGSAAALPGSFSWSSSGILMSPKPDSTHNIAGLKDPTVVYYNG
KYHVFASVASASGYSLVYLNFTDWSQAASAPHYYLDRSGIGTGYRAAPQVFYFAPQRTWY
LVYQTGNASYSTNTDISNPNGWSAPRNFYSSMPDIIKQNIGNGYWVDMWVICDSANCYLF
SSDDNGHLYRSQTTLAQFPNGFTNTVIAAQDSNKYALFEASNVYKVQGSNQYLLIVEAIG
SDGRRYFRSWTSSSIGGSWTQLAASESNPFARASNVTFPSGAWTRDISHGELVRAGYDQT
LTINPCKMQYLYQGMNPNASGDYNTLPWRLGLLTQTNSTC
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
gtgaagccacccggccgataccgaaccctcgcgttaggtctcctggccgccggcgtgatg
gcagtggccgggaccgccgcgcccgcgtccgccactgccacggccactgccactgccact
gactccgccgctgcgtccgactccgttcaggcgtccacactgggcgctcaggcggcccag
tccgggcggtacttcggggccgccgtggccgccggcagacttggcgacgggacgtactcg
accatcctggaccgcgagttcaacatggtcacccccgagaacgagatgaagtgggacacc
acggagcgctcccgcggctcgttcaacttcggccccgccgaccagatcgtgaaccgcgcc
acctcgcgtggccagcgggtacggggccacaccctggtctggcactcccagctgcccagc
tgggtcagctccatcggcgacgcgaacaccctgcgcagcgtgatgaacaaccacatcaac
ggcgtgatgggccactacaagggcaaggtctacgcctgggacgtggtgaacgaggcgttc
gccgacggcggcagcggagcgcaccgcccctcggtcttccagaacctgctgggcgacggc
ttcatcgaggaggccttccgtaccgcgcgggcggccgacgcctcggccaagctctgctac
aacgactacaacatcgagaactggaccgacgccaaaacccagggcgtctaccgcatggtg
cgcgacttcaagacgcgtggcgtgcccatcgactgcgtcggcttccaggcccacttcggc
accggcggcccgccggccagtttccagaccaccctgtcgaacttcgccgccctcggcgtg
gacgttcagatcaccgagctggacatcgcgcaggcaccgacgaccgcgtacgccaacacc
gtcaaggcctgcatgaacgtggcgcggtgcaacggcctcaccacatggggaatccgggac
accgactcctggcgcgccggggagaagccactgctcttcgacggcaacggcaacaagaag
gccgcatacaactcagcgctcaccgcgatgggcggcacccccgcggtgaagggcacggcg
aacaccgtgacgaagaccgcggcaaaggacccgacgaagaccccggcctcccccggctcg
gccgccgccctgcccggcagcttcagctggagctccagcgggatcctcatgtcccccaag
ccggactccacccacaacatcgccgggctcaaggacccgaccgtcgtctactacaacggc
aagtaccacgtgttcgccagcgtcgccagcgcctccggatacagcctggtgtacctgaac
ttcaccgactggtcccaggcagcctcggccccgcactactacctggaccgcagcgggatc
ggcaccggataccgggccgcaccccaggtgttctacttcgcaccccagcgcacctggtac
ctggtgtaccagaccggcaacgcctcgtactccaccaacaccgacatcagcaaccccaac
gggtggagcgcaccgcgcaacttctactcctccatgccggacatcatcaaacagaacatc
ggcaacggctactgggtcgacatgtgggtgatctgcgacagcgccaactgctacctgttc
tcctccgacgacaacggacacctgtaccgctcccagaccaccctcgcccagttccccaac
gggttcaccaacaccgtcatcgccgcccaggactccaacaaatacgccctcttcgaagcc
agcaacgtgtacaaggtccagggcagcaaccagtacctgctgatcgtcgaggccatcgga
tccgacggacggcgctacttccgctcctggacctccagcagcatcggcggctcctggaca
caactggccgcctccgagagcaacccgttcgcccgggccagcaatgtcaccttcccctcg
ggggcctggaccagggacatcagccacggcgagctggtccgcgccggatacgaccagacc
ctcaccatcaacccctgcaagatgcagtacctctaccagggcatgaaccccaacgccagc
ggcgactacaacaccctgccgtggcggctcggcctgctcacccagaccaactccacctgc
tga

DBGET integrated database retrieval system