KEGG   Streptomyces bingchenggensis: SBI_09959Help
Entry
SBI_09959         CDS       T01678                                 

Gene name
bga19
Definition
putative beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sbh00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(11853823..11855925)
Genome map
AA seq 700 aa AA seqDB search
MYEPAERVLFGAAYYHEYQPHDRLKEDLDLMAEARFSVIRVGESVWSTWEPENGRFALEW
LRPVLDGAHERGIGVIIGTPTYAVPPWLARQYPEIAGERRTGERIPWGHRQEVDFTHPAF
RFHAERVIRKIVEHYADHPAVVGFQVDNEPGVALLHNHGVFQRFVDDLRHRYQDVETLNR
EWGLVYWSHRLSDWADLWRPDGNAQPQYDLAWRRFQARQTTEFIAWQADLVREYARPGQF
VTTCISYDRVAAEDAELTKALDVTAGNPYYAMQDGLALPDRDTAPQGWASRGTWALYQSA
DRMYASRQEPFLVTETDAQAIGGPEMNYPAYDGQWRQAAWALISRGASMIEYWHWHTLHF
GTETFWGGILPHSGRPGRSYRELARLGEELETAGGLVAGLRPDADAAFLFDHPSMWALQH
QPPLSTPDGGPDTGSYGRLFGAFYRGAFDAGLQARIVHPDQLETADLPPLLVASGYYIAE
DQVLDRLLAYAQAGGHLLLGPRTGYADHEARARTDVQPARLAAAAGVAYEEFSNLASALP
VTGTDAMPLPSAARATAWADALSPTEAEVLAAYEHPHFARWPAVTTHRYGAGRITCVGTV
PDQSLARALFQWAATGTDPWRPGHPSITSTGATARDGSRLRFVHNWSWDQTAFPLPSPVR
DVLTGRRYAAGDTLPLGPWDVRVCVEEAVPPADPGADASE
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagcccgccgagcgggtccttttcggcgccgcttattaccacgagtaccagccg
cacgaccggctcaaggaggacctggacctgatggccgaggcccggttctcggtgatccgg
gtcggggagtccgtgtggtcgacctgggaaccggagaacggccggttcgcgctggagtgg
ctgcgcccggtgctggacggcgcgcacgagcgtgggataggggtgatcatcggcactccc
acctatgcggttccgccgtggctggccaggcagtaccccgagatcgcgggggagcggcgc
accggggagcggatcccgtggggccaccggcaggaggtcgacttcacccacccggcgttc
cgcttccacgccgagcgagtcatccgcaagatcgtggagcactacgccgaccaccccgcg
gtcgtcggcttccaggtcgacaatgagccgggcgtggcgcttctgcacaaccacggggtc
ttccagaggttcgtcgacgacctgcgccaccgctaccaggatgtcgagacgctcaaccgg
gagtggggcctggtctactggtcgcaccggctcagtgactgggctgacctgtggcgcccc
gacggcaacgcacagccgcagtacgacctggcgtggcggcgcttccaggcccgccagacc
accgaattcatcgcctggcaggccgacctcgtacgggagtacgccaggccggggcagttc
gtcaccacatgcatctcctacgaccgggtggcggccgaggacgccgaactgacgaaggcg
ctggatgtcactgccgggaacccgtactacgccatgcaggacggtctggcgctgccggac
cgggacaccgccccccaggggtgggcgagccgcgggacctgggccctgtaccagagcgcc
gatcggatgtacgcctcccggcaggagccgttcctggtcaccgagaccgacgcccaggcc
atcggcggcccggagatgaactacccggcctacgacggccagtggcgccaggcggcgtgg
gcactgatctcccgcggcgcgtccatgatcgagtactggcactggcacaccctgcacttc
ggcaccgagaccttctggggcgggatcctcccgcacagcggccgcccgggccgcagctac
cgggaactggcccggctgggggaggagctggagacggccggcggtctcgtcgcgggcctg
cgcccggacgccgacgcggccttcctcttcgaccaccccagcatgtgggcgctgcagcac
cagccgccgctttccacccccgacggcggtcccgacaccggctcctacgggcgcctgttc
ggcgccttctaccgcggcgccttcgacgcggggctgcaggcacgcatcgtccacccggac
cagctggagaccgccgacctgccgccgctgctggtcgcgtccggctactacatcgccgag
gatcaggtcctggaccggctgctggcgtacgcgcaagccggcggccatctcctgctcggt
ccgcgcaccggctacgccgaccacgaggccagggcgcgtaccgacgtccagcccgcacgc
ctggccgcagcggccggcgttgcttacgaggagttctccaacctggcgtcggcgctgccg
gtcaccggtacggatgcgatgccgctgccgtcggccgcgcgcgcgacggcctgggccgac
gcgttgtcccccaccgaggccgaggtactggccgcttacgaacacccgcacttcgcccgg
tggcccgcggtgaccacccaccgttacggagccgggcggatcacctgcgtgggcaccgtc
ccggaccagagcctggcccgcgcgctgttccagtgggccgccaccggcacggacccgtgg
cgccccggccacccgtcgatcacctccaccggggccaccgccagggacggcagccggctg
cgcttcgtgcacaactggtcatgggaccagaccgccttcccgctgccgagcccggtccgc
gatgtcctcaccggccggcggtacgcggccggcgacaccttgcctctgggcccgtgggac
gtgcgggtgtgcgtcgaggaagccgtgccgccggccgaccctggagccgacgcgagcgag
tag

DBGET integrated database retrieval system