KEGG   Sorghum bicolor (sorghum): 8081314Help
Entry
8081314           CDS       T01086                                 

Definition
(RefSeq) photosystem II reaction center PSB28 protein, chloroplastic
  KO
K08903  
photosystem II 13kDa protein
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Photosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    8081314
Photosynthesis proteins [BR:sbi00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    8081314
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
3
AA seq 176 aa AA seqDB search
MAAVMKALAVASPVSARAAQQPRRYVAGGASQLQSSFHGVSVQCPGRPRQATPRRGVQVV
MMAARPSIQFIQGTDEQTIPDVRLTKSRDGTNGVAIFTFEQPSVFDSSAELGDITGLYMI
DDEGVLQSVDVSAKFVNGKPARIEAKYVMRTPRDWDRFMRFMERYSQANGLQFVKN
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagtgatgaaggctctcgcggtcgcctcgccggtgtcggcacgggcagcgcag
cagccccgtcggtacgtcgcaggtggcgctagccagcttcagtcgtcgttccacggcgtg
tcggtgcagtgccctgggcgaccgcggcaggcaacgccccggcggggggtgcaggtggtg
atgatggcggctcggccgtcgatccagttcatccagggcacggacgagcagacgatcccg
gacgtgcggctgaccaagtcccgggacggcaccaacggcgtggccatcttcacgttcgag
cagccgtcggtgttcgactcgtcggcggagctcggggacatcacgggcctctacatgatc
gacgacgagggcgtgctgcagtccgtggacgtcagcgccaagttcgtcaacggcaagccg
gcgcggatcgaggccaagtacgtcatgcgcacgccccgggattgggaccgcttcatgcgc
ttcatggagcgatactcccaggccaacggcctccagttcgtcaagaactga

DBGET integrated database retrieval system