KEGG   Sorghum bicolor (sorghum): 8082557Help
Entry
8082557           CDS       T01086                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 6
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00052  Galactose metabolism
sbi00500  Starch and sucrose metabolism
sbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    8082557
   00500 Starch and sucrose metabolism
    8082557
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     8082557
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 8082557
NCBI-ProteinID: XP_021318463
Position
6
AA seq 590 aa AA seqDB search
MAALLLAIRVITVFLICLLLPTSSSSSSICIARTQDHVRTAFHFQPAKNWQNDPNGPVYY
NGMYHLFYQYNPHGALWDVGNLSWGHSVSGDLVNWAALGNALDPTAPFDANGCASGSVTI
LPDGTPGILYSGIDTDRRQVQNIAFPKNPRDPLLREWAKPAYNPVVPLPADVSANDFRDP
TTAWLGRDGLWRFAISAVADGVGATLVYRSADFLRWERRATPLHASRDAVMAECPDLFPV
ATRGGAEEGLDTSASGKGVRHVLKVSMPDTLEDYYAVGTYDDGADTFTPDEDGDYRSWRR
IDRGHLYASKTFFDARRSRRVLWAWVNESDSEADDVARGWSGLQSFPRALWLDGGGKQLV
QWPVEEIETLRTRRAPPLEGAELEPAGGLREVTGIRSSQADVDVVFEIPSLGRAEGLDPS
RLADPDALCREKGASVRGGVGPFGLLVMASGDLHEHTAVFFRVFRLLHEYAVLMCTDLSR
SYTKADVYKPTHGGFINVDIEKDMSISLRTLIDHSIVESFGGGGRTCMTARVYPEHVVTG
SSHLYVFNNGSDAVKVSKLEAWELASASVNVDDDGGLVGSSVNMCHSEMY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggcagcacttctccttgctatacgcgtcatcacggtgttcttgatctgccttcttctc
cccacttcgtcgtcttcgtcatcgatttgcatcgcgaggacgcaggaccatgtgagaact
gcgtttcacttccagcccgccaagaactggcagaacgatccgaatgggcccgtgtactac
aacggcatgtaccacctgttctaccagtacaacccgcacggcgcgctctgggacgtgggc
aacctctcctggggccactccgtctccggcgacctcgtgaactgggcggccctcggcaac
gcgctggacccgacggcgccgttcgacgccaacggctgcgcgtcagggtctgtcaccatc
cttccggacggcacgccggggatcctctactccggcatcgacacggaccgccggcaggtc
cagaacatcgcgttccctaagaacccgcgcgacccgctcctccgcgagtgggccaagcca
gcctacaacccggtcgtcccgctccccgccgacgtgtcggcgaacgacttccgggacccc
accacggcgtggctgggccgggacgggctgtggcggttcgccatctccgcggtggccgac
ggcgtgggcgccacgctcgtgtaccgcagcgcggacttcctgcgctgggagcggcgcgcc
acgccgctgcacgcgtcgcgggacgccgtgatggccgagtgcccggacctgttccccgtg
gcgacgcgcggcggcgcggaggaggggctggacacgtcggcgagcggcaagggcgtgcgg
cacgtcctcaaggtgagcatgccggacacgctggaggactactacgcggtcgggacgtac
gacgacggggcggacacgttcacgccggacgaggacggcgactaccgcagttggcggagg
atcgaccgcgggcacctgtacgcgtccaagacgttcttcgacgcgcgcaggagccggcgg
gtgctgtgggcgtgggtgaacgagtccgacagcgaggccgacgacgtcgcccggggctgg
tccggcctccagtcgttcccgcgggcgctgtggctggacggcggcgggaagcagctggtg
cagtggcccgtggaggagatcgagacgctgaggacgaggcgcgcgccgccgcttgagggt
gcagagttggagcctgccggcgggctgcgcgaggtcacggggatccggagctcgcaggcg
gacgttgacgtcgtgttcgagatcccgagcctcggtcgcgccgagggactcgaccccagc
cggctggctgaccctgacgcgctgtgccgggagaagggcgcctccgtgcgaggcggggtc
ggcccgttcgggctgctggtgatggcctccggcgacctgcatgagcacaccgccgtgttc
ttcagggtgttcaggctcctgcacgagtacgctgttctcatgtgcacggacctcagcagg
tcctacacgaaggcagacgtgtacaagccaacgcatggagggttcatcaacgtggacatc
gagaaagacatgagcatatcgttaagaacattgatcgatcactcgatcgtggagagcttc
ggcggcggagggaggacgtgcatgacggccagagtgtaccccgagcacgttgtaacaggt
agcagccacctgtacgtgttcaacaatggatcggatgcagtgaaggtgtccaagctcgag
gcatgggaacttgccagtgcgagtgtcaatgtcgacgatgatggcggtctggttggttca
tccgtgaacatgtgccacagcgagatgtattag

DBGET integrated database retrieval system