KEGG   Sorghum bicolor (sorghum): 8155383Help
Entry
8155383           CDS       T01086                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 2
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    8155383
   00500 Starch and sucrose metabolism
    8155383
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     8155383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
6
AA seq 594 aa AA seqDB search
MRVVGMVAWACIWLLLLQLAGASHVVYDENLEVEAAAAAVPPSIVDPLLRTGYHFQPRKN
WINDPNAPLYYKGWYHIFYQYNPKGAVWGNIVWGHSVSRDLINWVALKPAIEPSIPSDKY
GCWSGSATTLPDGTPAIMYTGVNRPDVNYQVQNIAYPRNKSDPLLREWVKPSHNPIIVPK
AGVNATQFRDPTTAWRHADGGGHWRLLIGSLEGAARGVAYVYRSRDFKRWTRVRRPLHSA
ATGMWECPDFYPLSTAGRRMGVETSSSSAAAAGSRRRQANKYVLKNSLDLRRYDYYTIGT
YDPAAERYVPDDPAGDERHLRYDYGNFYASKTFYDPAKRRRILWGWANESDTAADDVAKG
WAGIQAIPRTVWLDPSGKQLLQWPIEEVEALRGKSVTLKNRVIKPGQHVEVTGIQTAQAD
VEVSFEVPSLAGAEALDDPALAGDAQRLCGARGAAVEGGVGPFGLWVLASANREERTAVF
FRVFRPARGGGKPVVLMCTDPCKSSLDPNLYQPTFAGFVDTDISNGKISLRSLIDRSVVE
SFGAGGKTCILSRVYPSLAIGKNARLYVFNNGKADVKVSSLTAWEMKKPLMNGA
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgagggtggttggaatggttgcttgggcatgcatatggctgctgctcctgcagctcgcc
ggggcttctcatgtcgtctacgatgagaacctcgaggtggaggcggcggcagccgccgtg
ccgccctccattgtcgaccccctgctgaggacagggtaccatttccagcctcgcaagaac
tggatcaatgatcccaacgctccattgtactacaaggggtggtaccacatcttctaccaa
tacaaccccaaaggcgccgtgtggggcaacatcgtgtggggccactcggtgtcgcgagac
ctcatcaactgggtggccctgaagccggcgatcgagcccagcatcccgtccgacaagtac
ggctgctggtcagggtcggcgaccacgctccccgacggcacgccggcgatcatgtacacg
ggcgtgaaccgtcccgacgtgaactaccaggtgcagaacatcgcgtaccctcggaacaag
tcggacccgctgctccgggagtgggtgaagccctcgcacaacccgatcatcgtccccaag
gccggcgtcaacgcgacgcagttccgggaccccaccacggcgtggcgccacgccgacggc
ggcggccactggcggctgctcatcggcagcctggagggcgccgcccgcggcgtggcgtac
gtgtaccggagccgcgacttcaagcggtggacgcgggtccggcggccgctgcactcggcg
gccacggggatgtgggagtgcccggacttctacccgctcagcacggccggccggcgcatg
ggtgtcgagacgtcgtcgtcgtcggcggcggcggcgggctctcgccgtcgtcaggcgaac
aagtacgtgctgaagaacagcctggacctgcggcggtacgactactacaccatcggcacg
tacgacccggcggcggagcggtacgtgccggacgaccccgccggcgacgagcgccacctg
cggtacgactacggcaacttctacgcgtccaagacgttctacgacccggcgaagcggcgg
cggatcctgtggggctgggccaacgagtccgacaccgccgccgacgacgtcgccaaaggg
tgggctgggattcaggcgattccgaggacggtgtggctggatcccagcgggaagcagctg
ctgcagtggcctatcgaggaagtggaggcgctcagaggcaagtcggtcactctcaagaac
agggtgatcaagccaggacagcacgtcgaggtgaccgggatacaaacggcacaggctgac
gtggaggtgagcttcgaggtgccgagcctggcgggagcggaggcgctggacgacccggcg
ctcgccggcgacgcgcagcggctgtgcggcgccaggggcgccgccgtggagggcggcgtc
ggaccgttcgggctctgggtgctggcctccgccaaccgggaggagaggaccgccgtgttc
ttcagggtgttcaggcccgcgcgcggcggcggcaagccggtggtgctcatgtgcaccgac
ccctgcaagtcatctctggacccgaacctgtaccagccgacgtttgcaggttttgtggac
acagacatttctaacggcaagatctctctgagaagcctgatcgaccggtcggttgttgag
agctttggagccgggggcaagacgtgcatcctctccagggtctacccgtcgctcgccatc
ggcaagaacgcccgcctctacgtgttcaacaacgggaaggcggacgtcaaggtgtccagt
ctcaccgcatgggagatgaagaagccactcatgaatggagcttga

DBGET integrated database retrieval system