KEGG   Sorghum bicolor (sorghum): SORBI_0010s007790Help
Entry
SORBI_0010s007790 CDS       T01086                                 

Gene name
SORBIDRAFT_0010s007790, Sb0010s007790
Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SORBI_0010s007790 (SORBIDRAFT_0010s007790)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SORBI_0010s007790 (SORBIDRAFT_0010s007790)
Enzymes [BR:sbi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SORBI_0010s007790 (SORBIDRAFT_0010s007790)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 205 aa AA seqDB search
MIEATRGLRGPRLLLSVAVLVLAIALVFRSLTPAVPQMADDLPTSIYDITVKDIRGDDIE
LSEYAGKVLLIVNVASKCGLTSSNYKELNVLYEKYREKGLEILAFPCNQFAGQEPGTNED
IQETVCSRFKAEFPIFDKIDVNGKDAAPLYKYLKSQKGGFLGDGIKWNFTKFLVDKDGKV
VERYAPTTSPLKIENDIQKLLGTAS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgattgaggctacaagagggctcaggggcccccgactcctcctgtccgtcgccgtcctc
gtcctcgccattgctctcgtcttccgctccctcaccccggcagtcccgcaaatggccgac
gacctgcccacctccatctacgacatcaccgtcaaggatattaggggtgatgacatagaa
ctaagcgagtatgctggaaaggttcttcttatcgtcaatgttgcttcaaaatgtggacta
acaagttccaattacaaagagctaaatgtcttgtatgagaagtacagagagaaaggcctt
gagatacttgcattcccatgtaatcaatttgctggtcaagagcctggcaccaatgaagat
atccaggagacagtttgtagcaggttcaaagcagagtttcctatttttgacaagattgat
gtgaatggtaaggacgctgcaccattgtacaagtacttgaaatcacagaaaggtggcttc
cttggcgatggtattaaatggaacttcaccaagtttcttgttgacaaagatggcaaggtt
gttgagcgatatgctccgacgacttctcctttgaagattgagaatgacatccagaagctt
ctgggcacagcatcatga

DBGET integrated database retrieval system