KEGG   Sorghum bicolor (sorghum): SORBI_01g003330Help
Entry
SORBI_01g003330   CDS       T01086                                 

Gene name
SORBIDRAFT_01g003330, Sb01g003330
Definition
hypothetical protein
Orthology
K01859  
chalcone isomerase [EC:5.5.1.6]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    SORBI_01g003330 (SORBIDRAFT_01g003330)
Enzymes [BR:sbi01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.6  chalcone isomerase
     SORBI_01g003330 (SORBIDRAFT_01g003330)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 231 aa AA seqDB search
MAVPEVVVEGVVFPPVARPPGSAGSHFLGGAGVRGIEIGGNFIKFTAIGVYLEDAAVSAL
AKKWAGKTADELASDAAFFRDVVTGDFEKFTRVTMLLPLTGEQYAGKVTENCVAFWKAVG
LYTDAEGVAVEKFKEAFKPETFPPGASILFTHSSTGVLTVAFSKDSSVPASGGVAIENKH
LCEAVLESIIGEHGVSPAAKLSLAARVSELLTKGTAGAADAPQAEPVSVTA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgccggaggtggtggtcgagggcgtcgtcttcccgccggtggcccgcccgccg
ggctccgccggctcgcacttcctcggcggcgcaggcgtgcgaggcatcgagatcggaggc
aacttcatcaagttcacggccatcggcgtgtacctggaggacgcggccgtgtccgcgctg
gcgaagaagtgggccggcaagacggccgacgagctcgcgtccgacgccgccttcttccgc
gacgtcgtcacgggtgacttcgagaagttcacgagggtgaccatgctccttccgctcacg
ggcgagcagtacgcggggaaagtgacggagaattgcgtggcgttctggaaggccgtcggc
ctgtacacggacgccgagggcgtcgccgtggagaagttcaaggaggcgttcaagcccgag
acgttcccgccgggcgcctccatccttttcacgcactcgtccaccggagtcctcaccgtc
gccttctccaaggactcgtcggtgccggcgtccggcggcgtggcgatcgagaacaagcac
ctctgcgaggccgtgctggagtccatcatcggggagcacggcgtgtcgccggccgcgaag
ctgagcctcgcggcgagggtgtcggagctcctcaccaagggaaccgccggggccgccgac
gcgccgcaggcggagcccgtctcggtcaccgcctga

DBGET integrated database retrieval system