KEGG   Sorghum bicolor (sorghum): SORBI_01g003330Help
Entry
SORBI_01g003330   CDS       T01086                                 

Gene name
SORBIDRAFT_01g003330, Sb01g003330
Definition
hypothetical protein
Orthology
K01859  
chalcone isomerase [EC:5.5.1.6]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Biosynthesis of other secondary metabolites; Flavonoid biosynthesis [PATH:sbi00941]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 231 aa AA seqDB search
MAVPEVVVEGVVFPPVARPPGSAGSHFLGGAGVRGIEIGGNFIKFTAIGVYLEDAAVSAL
AKKWAGKTADELASDAAFFRDVVTGDFEKFTRVTMLLPLTGEQYAGKVTENCVAFWKAVG
LYTDAEGVAVEKFKEAFKPETFPPGASILFTHSSTGVLTVAFSKDSSVPASGGVAIENKH
LCEAVLESIIGEHGVSPAAKLSLAARVSELLTKGTAGAADAPQAEPVSVTA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgccggaggtggtggtcgagggcgtcgtcttcccgccggtggcccgcccgccg
ggctccgccggctcgcacttcctcggcggcgcaggcgtgcgaggcatcgagatcggaggc
aacttcatcaagttcacggccatcggcgtgtacctggaggacgcggccgtgtccgcgctg
gcgaagaagtgggccggcaagacggccgacgagctcgcgtccgacgccgccttcttccgc
gacgtcgtcacgggtgacttcgagaagttcacgagggtgaccatgctccttccgctcacg
ggcgagcagtacgcggggaaagtgacggagaattgcgtggcgttctggaaggccgtcggc
ctgtacacggacgccgagggcgtcgccgtggagaagttcaaggaggcgttcaagcccgag
acgttcccgccgggcgcctccatccttttcacgcactcgtccaccggagtcctcaccgtc
gccttctccaaggactcgtcggtgccggcgtccggcggcgtggcgatcgagaacaagcac
ctctgcgaggccgtgctggagtccatcatcggggagcacggcgtgtcgccggccgcgaag
ctgagcctcgcggcgagggtgtcggagctcctcaccaagggaaccgccggggccgccgac
gcgccgcaggcggagcccgtctcggtcaccgcctga

DBGET integrated database retrieval system