KEGG   Sorghum bicolor (sorghum): SORBI_01g003860Help
Entry
SORBI_01g003860   CDS       T01086                                 

Gene name
SORBIDRAFT_01g003860, Sb01g003860
Definition
hypothetical protein
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sbi00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 755 aa AA seqDB search
MATATALSTSLPHLPPRRAASFPSAAAVSLPVSSRAARLRESRLAAAAPAASEVLESTNG
AIPTAAKGGAGRGYGREYFPLAAVVGQDAIKTALLLGAIDREIGGIAISGKRGTAKTVMA
RGLHAMLPPIEVVVGSIANADPSSPDEWEDGLADQIQYDSDGNVKTEIVKTPFVQIPLGV
TEDRLIGSVDVEASVRSGTTVFQPGLLAEAHRGVLYVDEINLLDDGISNLLLNVLTEGVN
IVEREGISFRHPCKPLLIATYNPEEGSVREHLLDRIAINLSADLPMSFDDRVAAVDIATR
FQESSKEVFKMVEEETETAKTQIILAREYLKDVNISTEQLKYLVMEAIRGGCQGHRAELY
AARVAKCLAAMEGREKVFVDDLKKAVELVILPRSILSDNPQDQQQEQPPPPPPPPPPENQ
DSSEDQDEEDDDQEDDDEENEQQDQQIPEEFIFDAEGGLVDDKLLFFAQQAQRRRGKAGR
AKNVIFSEDRGRYIKPMLPKGPVRRLAVDATLRAAAPYQKLRREKERDKARKVFVEKTDM
RAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVSIIPFRGDYAE
VLLPPSRSIAMARKRLEKLPCGGGSPLAHGLSTAVRVGLNAEKSGDVGRIMIVAITDGRA
NVSLKRSTDPEAAAASDAPRPSSQELKDEILEVAGKIYKAGMSLLVIDTENKFVSTGFAK
EIARVAQGKYYYLPNASDAVISAATKTALTDLKSS
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggccaccgcgctctccacctcactcccgcacctcccgccccgccgtgccgcc
tcatttccctccgccgccgccgtttccctccccgtctcctcccgcgccgcccggctgcgg
gaatcccgcctcgcggccgcggcacccgcggcctccgaggtcctcgagtccaccaacggc
gccatccccaccgcggccaagggcggcgcggggcgtgggtacgggagggagtacttcccc
ctggctgccgtcgtcgggcaggatgctatcaaaaccgctctgctgcttggggcgattgat
cgtgagattggaggcattgccatctcagggaagcgtgggacggcaaagacggtgatggct
cgtggcttgcatgctatgcttccacctattgaagtggttgttggctccattgcaaatgct
gatcctagctccccagacgaatgggaggatggtttagctgatcaaatacagtatgactct
gatggtaatgtcaaaactgagattgtgaaaacaccttttgtgcagattccacttggtgtg
acagaggataggctcattggatcagttgatgttgaagcatctgtgagatcagggactact
gtatttcaacctggtcttcttgctgaagcacatagaggtgttctttatgttgatgagata
aatctattggatgatggcataagcaatctacttttgaatgtcttgacggagggagttaac
attgtggaaagagagggcattagctttcgccatccctgcaaaccacttctaattgctact
tacaacccagaggaaggatctgtgcgtgaacacttgcttgatcgtattgcaattaattta
agtgctgaccttccaatgagttttgatgaccgtgttgcagcagtggatattgcaacacgg
tttcaggagtctagcaaagaagttttcaaaatggtggaagaagaaactgaaactgcaaaa
actcagataattttggcaagagagtatctgaaggatgttaacattagcacagagcagctc
aaatatcttgtcatggaagctatacgaggtggctgtcaggggcatcgtgctgagttgtat
gctgctcgagttgcaaaatgccttgctgctatggaaggacgtgaaaaagtatttgtggat
gacctcaagaaagctgtagagctagtcattctacctcgctcgatcctatctgataaccca
caggatcagcagcaagagcaaccacccccacccccgccgccaccacctccagaaaatcaa
gattcctcagaagaccaagacgaggaagacgatgaccaagaggatgatgatgaagaaaat
gaacaacaagaccagcagatacctgaggagttcatctttgatgctgaaggtggtttagta
gatgataaactccttttctttgctcagcaagcacaaagacgacgtggaaaagctgggcga
gcaaagaatgtcatcttctcagaagataggggccgttacataaagcctatgcttccaaag
ggtccagtaaggaggttagctgttgatgccacgcttagagcagctgcaccataccaaaaa
ctgcgcagagagaaagaacgtgacaaggcaagaaaggtttttgttgaaaagactgacatg
agagccaaaagaatggctcgaaaagcaggtgctctagtcatatttgttgtggacgctagt
ggtagcatggctctgaatcgtatgcagaacgcgaaaggtgcggcattgaagttgcttgca
gaaagctacaccagcagagatcaggtttcaattattccttttcgtggagattatgctgag
gttttacttccaccatcaagatctatagcaatggcccggaaacgtcttgagaagctacca
tgtggtggtggttctcctttagctcatggcctcagtacagctgtcagagtgggtttgaat
gctgaaaagagtggcgatgtcgggcgtatcatgattgttgcaatcaccgatggaagagct
aatgtatcactgaagagatccactgatccagaagctgctgctgcttcagatgcaccaaga
ccttcgtctcaagaactaaaggatgagatacttgaggtggctggcaaaatatacaaggca
ggaatgtcccttcttgtcatcgacactgagaacaagtttgtatccacgggatttgccaag
gaaattgcaagggttgcccaagggaaatattattatctgcccaatgcttcagatgctgtg
atttctgctgccaccaagaccgctctgactgacttgaagagctcgtga

DBGET integrated database retrieval system