KEGG   Sorghum bicolor (sorghum): SORBI_01g004810Help
Entry
SORBI_01g004810   CDS       T01086                                 

Gene name
SORBIDRAFT_01g004810, Sb01g004810
Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:sbi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sbi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sbi00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sbi00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sbi00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sbi00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 538 aa AA seqDB search
METATVVVAPAPVAITQPPQQLMELKFSFAPVAKSSPATKAEPDKKKLTGGCGGYVLEDV
PHLTDYLPELKSYPNPLQDHPAYSVVKQYFVKPDETVAKKVVVHKSSARGTHFRRAGPRR
RVYFQSDEVRAAIVTCGGICPGLNTVIRELVCGLHDMYGVTSIHGIEGGYKGFYARNTVE
LTPRSVNGIHKRGGTLLGSSRGGQDTAKIVDSIQDRGFNQVYIVGGDGSQKGAASIHEEV
QRRGLKCAVVGVPKTIDNDIAVIDKSFGFDTAVEAAQRAIDAAHVEAECGENGIGVVKLM
GRNSGFIAMHATLASRDVDCCLIPESPFYLEGKGGLLEFVEKRLRDNGHMVIVVAEGAGQ
DLVAKGMPFANTHDASGNKVLLDVGLWLSQQIKEHFKKKPRFPITLKYIDPTYMIRAVPS
NASDNVYCTLLAHSALHGAMAGYTGFSVGPVNGRHAYIPFYRITEKQNKVSITDRMWARV
LCSTNQPCFLTEEDVEGAGLELEEEEPHMHMPLVEGGMQRLGQEQPVDVQRANGNGHL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggagaccgccaccgtcgtcgtggcgccggctccggtggccatcacccagccaccgcag
cagcttatggaattgaagttttcctttgcccctgtggcgaaatcgtcgccggcgacgaag
gccgagccggacaagaagaagctcaccggtggctgtggcgggtacgtccttgaagacgtc
ccgcacctcaccgactacctccccgagctcaagagctacccaaatcccctgcaagatcac
ccggcctactctgttgtcaagcagtacttcgtgaagccggacgaaacggtggcgaagaag
gtcgtggtgcacaagagcagcgcgcgggggacgcacttccgtcgcgccggcccgcggcgg
cgcgtctacttccagtccgacgaggtgagggcggcgatcgtcacctgcggcgggatctgc
ccgggcctcaacaccgtcatccgggagctcgtctgcggcctccacgacatgtacggcgtc
acctccatccacggcatcgagggcggctacaagggcttctacgcgcgcaacacggtggag
ctgacgccgcgctccgtcaacggcatccacaagcgcggcggcacgttgctgggctcctcc
cgcggcggccaggacacggccaagatcgtcgacagcatccaggaccgcgggttcaaccag
gtgtacatcgtcggcggcgacggctcgcagaagggcgcggcgtccatccacgaggaggtg
cagcgccgcgggctcaagtgcgccgtggtcggcgtgcccaagaccatcgacaacgacatc
gccgtcatcgacaagtcgttcggattcgacaccgccgtggaggcggcgcagcgcgccatc
gacgccgcgcacgtcgaggccgagtgcggcgagaacggcatcggggtcgtcaagctcatg
ggccggaacagcggcttcatcgccatgcacgccacgctcgccagccgcgacgtcgactgc
tgcctcatcccggagtcgcccttctacctcgagggcaagggcggcctcctcgagttcgtg
gagaagcgcctccgcgacaacggccacatggtcatcgtcgtggccgagggcgccggccag
gacctcgtcgccaagggcatgcccttcgccaacacccacgacgcctccggcaacaaggtg
ctcctcgacgtcgggctgtggctctcccagcagatcaaggagcatttcaagaagaagccc
aggttccccatcaccctcaagtacatcgacccgacgtacatgatccgcgccgtgccgtcc
aacgcctccgacaacgtctactgcacgttgctggcgcacagcgccctgcacggcgccatg
gccgggtacaccggcttcagcgtcgggccagtgaacggcaggcacgcctacatcccattc
tacaggatcaccgagaagcagaacaaggtgtcgatcacggaccggatgtgggcgcgggtg
ttgtgctcgaccaaccagccgtgcttcctgacggaagaggacgtcgagggggcggggctg
gagctggaggaggaggagccgcacatgcacatgccactcgttgagggcggcatgcaacgc
cttggtcaggaacaacccgtcgatgtgcaacgggccaacggcaatggccacctctga

DBGET integrated database retrieval system