KEGG   Sorghum bicolor (sorghum): SORBI_01g008590Help
Entry
SORBI_01g008590   CDS       T01086                                 

Gene name
SORBIDRAFT_01g008590, Sb01g008590
Definition
hypothetical protein
Orthology
K10886  
DNA-repair protein XRCC4
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:sbi03450]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 283 aa AA seqDB search
MAAASSVAPARHSCAKLSVPVEDPKAVAAGAGTVFVKATWLPSRFSLAVTDGAGAWVADA
SDHEVRLRAEQWDQPVTDYLALAERYLAFQQPDSTYSFHDAGKGNRRLSWTFERQGTKLE
WRWKLQPSPNTQQTISEILDFLMDANIRLSEEVVRKTQSFDKLKQEAEKCLQQSERFNNE
KTEFEQATFSKFVAVLNSKKAKLRQLRDKVVELESAGKPPKEEVEQQEENSTDRTELFEG
ESDKEASINDEPSETGSGNVHSSPERSAATSRGRGRGRKRAKK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcctcttccgtggcgccggcgaggcacagctgcgcgaagctctcggttccg
gtggaggaccccaaggcggtggcggcgggcgcaggcaccgtcttcgtcaaagccacgtgg
ctgccgtcccgcttctccctcgccgtgaccgatggtgccggcgcctgggtcgccgacgcc
tccgaccacgaggtgcgcctccgcgccgagcagtgggaccagcccgtcaccgattacctc
gccctcgccgagcgctacctcgccttccaacagcctgattccacgtactccttccacgac
gccggcaaaggcaaccgcaggctctcatggacatttgaaagacaaggtaccaagttggaa
tggcgatggaagctgcagccttcaccaaacacacagcagactatatctgagatcctggat
tttcttatggatgcaaatatacgcttgagtgaagaggttgttaggaaaacacaatccttc
gacaagttgaaacaagaagctgagaagtgcttgcaacaaagtgaaagatttaacaatgaa
aaaactgagtttgaacaagccaccttttcaaagtttgtggctgtgttaaattcgaagaag
gccaagctcagacaactcagagataaagttgtggaacttgaatctgctggcaagcctccc
aaggaggaggttgagcagcaggaggagaactcaacggaccggacagagctcttcgaggga
gaaagtgacaaagaagcaagcatcaatgatgagccctccgagacaggcagtggcaatgtt
catagttctcctgagagatcggcagctacctcgaggggaagaggaagaggtcgcaagaga
gcgaagaaatag

DBGET integrated database retrieval system